Align Methylisocitrate lyase (EC 4.1.3.30) (characterized)
to candidate WP_090272481.1 BLU11_RS05815 methylisocitrate lyase
Query= reanno::pseudo6_N2E2:Pf6N2E2_6061 (294 letters) >NCBI__GCF_900105005.1:WP_090272481.1 Length = 294 Score = 426 bits (1096), Expect = e-124 Identities = 212/292 (72%), Positives = 242/292 (82%) Query: 3 NSTPGQRFRDAVANEHPLQVVGTINANHALLAKRAGFKAIYLSGGGVAAGSLGVPDLGIT 62 N TPGQRFR A+A E PLQV+G INANHALLAKRAGFKAIYLSGGGVAAGSLG+PDLGI Sbjct: 2 NKTPGQRFRQALAEEQPLQVIGAINANHALLAKRAGFKAIYLSGGGVAAGSLGLPDLGIN 61 Query: 63 GLDDVLTDVRRITDVCDLPLLVDVDTGFGSSAFNVARTVKSMIKFGAAAIHIEDQVGAKR 122 L+DVL DVRRITDVCDLPL+VD+DTGFG SAFN+ RTVKS+IK GAAA HIEDQVGAKR Sbjct: 62 TLEDVLIDVRRITDVCDLPLMVDIDTGFGPSAFNIERTVKSLIKAGAAAAHIEDQVGAKR 121 Query: 123 CGHRPNKEIVSQQEMVDRIKAAVDARTDDSFVIMARTDALAVEGLESALDRAAACIEAGA 182 CGHRP KEIVS +EMVDR++AA DA+TD F ++ARTDA+ EG+E+AL+R +EAGA Sbjct: 122 CGHRPGKEIVSTEEMVDRVRAAADAKTDPDFFLIARTDAIQAEGVEAALERCKRYVEAGA 181 Query: 183 DMIFPEAITELEMYKLFASRVKAPILANITEFGATPLYTTEQLAGADVSLVLYPLSAFRA 242 D IF EA +L Y+ F + P+LANITEFGATPL+T E+LA V++ LYPLSAFRA Sbjct: 182 DAIFAEAAYDLPTYERFVKELNVPVLANITEFGATPLFTREELASVGVAIQLYPLSAFRA 241 Query: 243 MNKAAENVYTAIRRDGTQQNVIDTMQTRMELYDRIDYHTFEQKLDALFAAKK 294 NKAAENVY A+R +G QQNVID+MQTR ELYDRI YH FE KLDALFAA K Sbjct: 242 ANKAAENVYNAVRTEGHQQNVIDSMQTREELYDRIGYHVFEGKLDALFAAGK 293 Lambda K H 0.320 0.134 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 294 Length adjustment: 26 Effective length of query: 268 Effective length of database: 268 Effective search space: 71824 Effective search space used: 71824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_090272481.1 BLU11_RS05815 (methylisocitrate lyase)
to HMM TIGR02317 (prpB: methylisocitrate lyase (EC 4.1.3.30))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02317.hmm # target sequence database: /tmp/gapView.1365203.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02317 [M=285] Accession: TIGR02317 Description: prpB: methylisocitrate lyase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-127 410.4 0.5 2e-127 410.2 0.5 1.0 1 NCBI__GCF_900105005.1:WP_090272481.1 Domain annotation for each sequence (and alignments): >> NCBI__GCF_900105005.1:WP_090272481.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 410.2 0.5 2e-127 2e-127 2 284 .. 6 290 .. 5 291 .. 0.99 Alignments for each domain: == domain 1 score: 410.2 bits; conditional E-value: 2e-127 TIGR02317 2 gkalrellkkedilqipGainalvallaekaGfeavYlsGaalaa.slglPDlglttleevaeearritrvtk 73 g+++r++l++e++lq++Gaina++alla++aGf+a+YlsG+++aa slglPDlg+ tle+v+ ++rrit+v++ NCBI__GCF_900105005.1:WP_090272481.1 6 GQRFRQALAEEQPLQVIGAINANHALLAKRAGFKAIYLSGGGVAAgSLGLPDLGINTLEDVLIDVRRITDVCD 78 789****************************************999*************************** PP TIGR02317 74 lpllvDaDtGfGe.alnvartvkeleeagvaavhieDqvapkkCGhldgkelvskeemvkkikaavkakkded 145 lpl+vD+DtGfG a+n++rtvk+l++ag+aa hieDqv +k+CGh++gke+vs+eemv++++aa++ak+d+d NCBI__GCF_900105005.1:WP_090272481.1 79 LPLMVDIDTGFGPsAFNIERTVKSLIKAGAAAAHIEDQVGAKRCGHRPGKEIVSTEEMVDRVRAAADAKTDPD 151 ************769********************************************************** PP TIGR02317 146 fvliaRtDaraveGldaaieRakaYveaGadaiftealeseeefrefakavkvpllanmtefGktplltadel 218 f+liaRtDa eG++aa+eR+k YveaGadaif+ea ++ +++f k+++vp+lan+tefG tpl+t +el NCBI__GCF_900105005.1:WP_090272481.1 152 FFLIARTDAIQAEGVEAALERCKRYVEAGADAIFAEAAYDLPTYERFVKELNVPVLANITEFGATPLFTREEL 224 ************************************************************************* PP TIGR02317 219 eelgykiviyPvtalRaalkaaekvyeelkkkGtqkelldklqtRkelYellgyedyekkdkelfk 284 +++g++i +yP++a+Raa+kaae+vy+ ++ +G q++++d++qtR+elY+ +gy+ +e k++ lf+ NCBI__GCF_900105005.1:WP_090272481.1 225 ASVGVAIQLYPLSAFRAANKAAENVYNAVRTEGHQQNVIDSMQTREELYDRIGYHVFEGKLDALFA 290 ************************************************************999985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (285 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 21.06 // [ok]
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory