Align Sugar ABC transporter ATP-binding protein (characterized, see rationale)
to candidate WP_090276009.1 BLU11_RS18855 sulfate ABC transporter ATP-binding protein
Query= uniprot:A0A165KQ08 (355 letters) >NCBI__GCF_900105005.1:WP_090276009.1 Length = 374 Score = 206 bits (525), Expect = 6e-58 Identities = 112/288 (38%), Positives = 172/288 (59%), Gaps = 11/288 (3%) Query: 4 SLDIAGINKRFGKGDKSVEVLRKVDIHVAPGEFLILVGPSGCGKSTLLNIIAGLDEPTEG 63 S+ I GI+K FG S + L+ + + + G+ + L+GPSG GK+TLL IIAGL+ G Sbjct: 2 SISIEGISKHFG----SFQALKNISLDIPDGQLVGLLGPSGSGKTTLLRIIAGLETADSG 57 Query: 64 EIRIGGKNVVGMPPRDRDIAMVFQSYALYPTLSVADNIGFALEM----RKMPKPERQKRI 119 I G++V + R+R + VFQ YAL+ ++VA N+ F LE+ + P E +KR+ Sbjct: 58 RILFHGEDVTNLHVRERKVGFVFQHYALFRHMTVAQNVAFGLEVLPARERPPAAEIRKRV 117 Query: 120 DEVAAMLQISHLLDRRPSQLSGGQRQRVAMGRALARQPQLFLFDEPLSNLDAKLRVEMRA 179 D + M+Q+ L +R P+QLSGGQ+QR+A+ RAL+ +PQ+ L DEP LDAK+R ++R Sbjct: 118 DMLLEMVQLGQLAERYPAQLSGGQKQRIALARALSMKPQILLLDEPFGALDAKVRKDLRR 177 Query: 180 EIKRLHQASGITSVYVTHDQVEAMTLGSRIAVMKGGVVQQLGTPDEIYNRPANTYVATFI 239 ++ LH TSV+VTHDQ EA+ L ++AVM G ++Q+ P ++Y P + +V F+ Sbjct: 178 WLRALHAEFHFTSVFVTHDQEEALELSDQVAVMSAGRIEQVDRPQQLYAEPTSRFVFDFL 237 Query: 240 GSPTMNLLRGAVTGGQFGIQGAALNLAPPPSSANEVLLGVRPEHLVMQ 287 G +N+ G G QG A P ++ L +RP + +Q Sbjct: 238 GH--VNVFAGDQQGSSLS-QGDAWVRLPANAAEQAAQLYMRPHEVSLQ 282 Lambda K H 0.318 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 355 Length of database: 374 Length adjustment: 29 Effective length of query: 326 Effective length of database: 345 Effective search space: 112470 Effective search space used: 112470 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory