Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate WP_090272465.1 BLU11_RS05735 ABC transporter ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >NCBI__GCF_900105005.1:WP_090272465.1 Length = 226 Score = 136 bits (343), Expect = 3e-37 Identities = 83/207 (40%), Positives = 117/207 (56%), Gaps = 7/207 (3%) Query: 35 VLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQVDGIDLAATTRE--AA 92 +L D+ L + G + + G SGSGKSTL+ + L++ G + + G L+A + AA Sbjct: 24 ILDDVSLSIARGSSVAIVGASGSGKSTLLSLLAGLDLPSSGEVILAGESLSALDEDQRAA 83 Query: 93 QVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEERARMYLSKVGIESQAHKY 152 +G VFQ F L ++ L+N +L P + G R+DA RAR L +VG+ + Y Sbjct: 84 LRAEHVGFVFQSFQLLDSLNALENVML-PLELDG--RRDAAVRARQLLERVGLNQRTSHY 140 Query: 153 PSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEVLDVLVQL-AGTGMTMLCV 211 P QLSGG+QQRVAIARA +P I+ DEPT LD A + D+L +L G T++ V Sbjct: 141 PRQLSGGEQQRVAIARAFASEPAILFADEPTGNLDAVTGARITDLLFELNREQGTTLVMV 200 Query: 212 THEMGFARQVAERVLFLEGGQIIEDSP 238 TH+ A Q E L +E G+I ED P Sbjct: 201 THDERLA-QRCESALHIEAGRIREDQP 226 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 226 Length adjustment: 23 Effective length of query: 237 Effective length of database: 203 Effective search space: 48111 Effective search space used: 48111 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory