Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate WP_090273343.1 BLU11_RS10765 aspartate aminotransferase family protein
Query= BRENDA::P42588 (459 letters) >NCBI__GCF_900105005.1:WP_090273343.1 Length = 404 Score = 201 bits (512), Expect = 3e-56 Identities = 142/397 (35%), Positives = 213/397 (53%), Gaps = 38/397 (9%) Query: 71 GSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELL--DPLRAM 128 G + L D QG+E+ID GG + ++GH +P +V A+ Q A++ H ++ +P + Sbjct: 30 GDGSRLWDQQGREYIDLAGGIAVNSLGHAHPQLVEALTEQ-AQKLWHVSNIMTNEPALRL 88 Query: 129 LAKTLAALTPGKLKYSFFCNSGTESVEAALKLAKAY---QSPRGKFTFIATSGAFHGKSL 185 K +AA K+ F NSG E+ EAA KLA+ + QS K IA S +FHG++L Sbjct: 89 ADKLVAATFADKV---LFVNSGAEANEAAFKLARRWAHDQSGPDKHEIIACSNSFHGRTL 145 Query: 186 GALSATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGG 245 +S + + + F P + G HVP+ +I A+ ++E AV++EP+QGEGG Sbjct: 146 FTVSVGGQPKYSQGFGPAISGISHVPYNDIAALEAQISE------RTCAVVVEPVQGEGG 199 Query: 246 VILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGG 305 VI YL AVR LCD++ AL+I DEVQ+GMGRTGK++A H V PDIL AK +GGG Sbjct: 200 VIPASIEYLKAVRALCDKYNALLIFDEVQSGMGRTGKLYAYMHSGVAPDILTSAKGIGGG 259 Query: 306 VMPIGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDM 365 PI A + + V L + H +T+GGNPL CA A ++++ + ++ Sbjct: 260 -FPIAAMLTIDRVAPAL--SVGTHGSTYGGNPLGCAVAERVLDIINTPQVLDGVGERQAQ 316 Query: 366 LLDGFRQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQR------VLVAGTL 419 L G R LA E + E RG+G+L+ + G A ++ R VL AG Sbjct: 317 LTAGLRILADEL-GVFSEIRGQGLLIGAVLAERWRGQ--AGQVMRLAQEEGLLVLQAG-- 371 Query: 420 NNAKTIRIEPPLTLTIEQCELVIKAARKALAAMRVSV 456 A +R+ P +L I + ++ R+AL MR ++ Sbjct: 372 --ADVVRLAP--SLIIPEADI-----REALGRMRAAL 399 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 404 Length adjustment: 32 Effective length of query: 427 Effective length of database: 372 Effective search space: 158844 Effective search space used: 158844 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory