Align MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)
to candidate WP_090272717.1 BLU11_RS07240 ABC transporter ATP-binding protein
Query= TCDB::Q9X103 (369 letters) >NCBI__GCF_900105005.1:WP_090272717.1 Length = 357 Score = 248 bits (632), Expect = 2e-70 Identities = 141/337 (41%), Positives = 199/337 (59%), Gaps = 16/337 (4%) Query: 6 VVLENVTKVYENKVVAVKNANLVVEDKEFVVLLGPSGCGKTTTLRMIAGLEEITDGKIYI 65 V NV K Y+ + VKN +L + EF+ +LGPSG GKTT L M+AG E T G+I + Sbjct: 6 VSFRNVQKSYDGDTLVVKNFSLDISKGEFLTMLGPSGSGKTTCLMMLAGFETPTSGEIRL 65 Query: 66 DGKVVNDVEPKDRDIAMVFQNYALYPHMTVYENMAFGLKLRKYPKDEIDRRVREAAKILG 125 DG+++N + P R I MVFQNYAL+PHMT+ EN+A+ L +RK PK EI++RV + ++ Sbjct: 66 DGQMINKMAPHKRGIGMVFQNYALFPHMTIAENLAYPLTVRKMPKAEIEQRVNTSLDMVE 125 Query: 126 IENLLDRKPRQLSGGQRQRVAVGRAIVRNPKVFLFDEPLSNLDAKLRVQMRSELKKLHHR 185 + + +R P QLSGGQ+QR+A+ RA++ PK+ L DEPL LD LR QM+ E+K+LH R Sbjct: 126 MRDKKNRTPGQLSGGQKQRIALARALIFEPKLVLMDEPLGALDKNLREQMQYEIKRLHER 185 Query: 186 LQATIIYVTHDQVEAMTMADKIVVMKDGEIQQIGTPHEIYNSPANVFVAGFIGSPPMNFV 245 L T +YVTHDQ EA+TM+D+I V DG +QQ+ +P +Y PA FVA FIG N Sbjct: 186 LGITAVYVTHDQTEALTMSDRIAVFDDGIVQQVASPSVLYEEPATAFVANFIGE--NNAF 243 Query: 246 NARVVRGEGGLWIQASGFKVKVPKEF---EDKLANYIDKEIIFGIRPEDIYDKLFALAPS 302 R+ R G ++++P F E A ++ +RPE I + A Sbjct: 244 AGRLGRLANG------KRQIEMPNSFIQTEHDSAGQEGSPVVLSVRPERI---MLAPGED 294 Query: 303 PENTITGVVDVVEPLGSETILHVKVGD--DLIVASVN 337 EN T V + G V+V D D+++ +N Sbjct: 295 VENRFTARVKELIYHGDHIRACVRVFDQSDVVLKLIN 331 Lambda K H 0.319 0.138 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 357 Length adjustment: 29 Effective length of query: 340 Effective length of database: 328 Effective search space: 111520 Effective search space used: 111520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory