Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate WP_090274680.1 BLU11_RS14815 polyamine ABC transporter ATP-binding protein
Query= BRENDA::Q70HW1 (384 letters) >NCBI__GCF_900105005.1:WP_090274680.1 Length = 378 Score = 215 bits (548), Expect = 1e-60 Identities = 125/283 (44%), Positives = 169/283 (59%), Gaps = 11/283 (3%) Query: 21 VKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEGNLYIGDRRVNDVPPKDRDIA 80 V D L I E +G SG GK+T LR++AG E +EG + + + + +PP R I Sbjct: 36 VDDVTLTINRGEIFALLGGSGSGKSTLLRILAGFETPSEGRVLLDGQNITALPPHKRPIN 95 Query: 81 MVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAAKILDIAHLLDRKPKALSGGQ 140 M+FQ+YAL+PHMTV QN+AFGLK K+ EI RV E K++ +A RKP LSGGQ Sbjct: 96 MMFQSYALFPHMTVEQNIAFGLKQDKLSNTEISERVAEMLKLVHMAKYAKRKPHQLSGGQ 155 Query: 141 RQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRKLHQRLQTTVIYVTHDQTEAM 200 RQRVAL R++ + P++ L+DEP+ LD KLR QM+ E+ ++ +R+ T I VTHDQ EAM Sbjct: 156 RQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGVTCIMVTHDQEEAM 215 Query: 201 TMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPAMNFIRGEIVQD-GDAFYFRA 259 TM RI +M G I Q TP +Y P N VA F+GS +N GEIV D D Sbjct: 216 TMAQRIAIMDQGWIVQVGTPMDIYESPVNRHVAEFVGS--VNIFEGEIVADMDDHVIIEC 273 Query: 260 PSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEEVFMTT 302 P + ++ G +GV + A K + +RP E+VF+TT Sbjct: 274 PQLDRQIYLG-HGV--TTRAEDKSAIYALRP-----EKVFVTT 308 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 378 Length adjustment: 30 Effective length of query: 354 Effective length of database: 348 Effective search space: 123192 Effective search space used: 123192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory