Align glutaryl-CoA dehydrogenase (EC 1.3.8.6) (characterized)
to candidate WP_090274914.1 BLU11_RS15480 isovaleryl-CoA dehydrogenase
Query= metacyc::G1G01-166-MONOMER (393 letters) >NCBI__GCF_900105005.1:WP_090274914.1 Length = 393 Score = 217 bits (552), Expect = 5e-61 Identities = 141/384 (36%), Positives = 204/384 (53%), Gaps = 18/384 (4%) Query: 15 LDQQLTEEERMVRDSAYQFAQDKLAPRVLEAFRHEQTDPAIFREMGEVGLLGATIPEQYG 74 LD L E+ M+RDS FA ++APR EA R ++ ++R+ G++GLLG T+ E+YG Sbjct: 7 LDFFLGEDIDMLRDSVAGFAAKEIAPRAAEADRTDEFPMDLWRKFGDMGLLGLTVAEEYG 66 Query: 75 GSGLNYVCYGLIAREVERIDSGYRSMMSVQSSLVMVPINEFGTEAQKQKYLPKLASGEWI 134 GSG+ Y+ + + E+ R G S+L + I+ G+EAQKQK+LPKL SGE I Sbjct: 67 GSGMGYLAHMIAMEEISRAAGGIGLSYGAHSNLCVNQIHRNGSEAQKQKFLPKLISGEHI 126 Query: 135 GCFGLTEPNHGSDPGSMITRARKVDGGYRLTGSKMWITNSPIADVFVVWAKDD----AGD 190 G ++EPN GSD SM RA K Y L G+KMWITN P V VV+AK D A Sbjct: 127 GALAMSEPNAGSDVVSMKLRADKKGDRYVLNGTKMWITNGPDCHVLVVYAKTDLTAGAKG 186 Query: 191 IRGFVLEKGWQGLSAPAIHGKVGLRASITGEIVMDNVFVPEENIFPDV-RGLKGPFTCLN 249 + F+L+ G S K+G+R S TGE+V +NV +PEENI + G K + L+ Sbjct: 187 MTAFILDTNTPGFSVAQKLDKLGMRGSHTGELVFNNVEIPEENILGGLGEGTKVLMSGLD 246 Query: 250 SARYGISWGALGAAEACWHTARQYTLDRQQFGRPLAANQLIQKKLADMQTEITLALQGCL 309 R +S G +G +A Y DR+QFG+ + QLIQ K+ADM + + Sbjct: 247 YERAVLSGGPMGLMQASMDIVTPYIHDRKQFGQSIGEFQLIQGKVADMYSTLQACRAYLY 306 Query: 310 RLGRMKDE-GTAAVEITSIMKRNSCG--------KALDIARMARDMLGGNGISDEFGVAR 360 +G+ D G+ V R C KA +A A +LGGNG +++ R Sbjct: 307 SVGKYLDAMGSGHVR----QVRKDCAGVILYTAEKATWMAGEAIQILGGNGYINDYPTGR 362 Query: 361 HLVNLEVVNTYEGTHDVHALILGR 384 + ++ GT ++ +++GR Sbjct: 363 IWRDAKLYEIGAGTSEIRRMLIGR 386 Lambda K H 0.320 0.137 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 393 Length adjustment: 31 Effective length of query: 362 Effective length of database: 362 Effective search space: 131044 Effective search space used: 131044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory