Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate WP_090275879.1 BLU11_RS18455 methionine ABC transporter ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >NCBI__GCF_900105005.1:WP_090275879.1 Length = 334 Score = 167 bits (422), Expect = 4e-46 Identities = 94/223 (42%), Positives = 138/223 (61%), Gaps = 2/223 (0%) Query: 43 LNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAF 102 L+ L I AG+++ I+G SG+GKSTL+R INRL EP++G ++ G++ L A+ LR F Sbjct: 21 LHATDLTIEAGQVYGIIGHSGAGKSTLLRLINRLEEPSNGRIMVAGEDTTALNAEGLRRF 80 Query: 103 RMRRVSMVFQSFALMPHRTVLQNVVYGQRVRG-VSKDDAREIGMKWIDTVGLSGYDAKFP 161 R +RV M+FQ F L+ TV NV R+ G ++ +D VGLS + +K+P Sbjct: 81 R-QRVGMIFQHFNLLSSATVADNVALPLRLAGSANRQQIAARVASLLDRVGLSDHASKYP 139 Query: 162 HQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAKTIVFIT 221 QLSGG KQRVG+ARALA + ++L DEA SALDP G + L ++ R L TIV IT Sbjct: 140 AQLSGGQKQRVGIARALATEPSILLCDEATSALDPHTTGQVLQLLSEINRELNLTIVLIT 199 Query: 222 HDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPANDYVARFV 264 H++D R+ ++A++ G++V+ GT D+ +P + FV Sbjct: 200 HEMDVIRRVCDQVAVMDGGRIVEQGTVADVFLHPQHPTTRSFV 242 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 258 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 334 Length adjustment: 27 Effective length of query: 248 Effective length of database: 307 Effective search space: 76136 Effective search space used: 76136 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory