Align putrescine-pyruvate transaminase (EC 2.6.1.113) (characterized)
to candidate WP_090275926.1 BLU11_RS18580 aspartate aminotransferase family protein
Query= BRENDA::Q9I6J2 (456 letters) >NCBI__GCF_900105005.1:WP_090275926.1 Length = 447 Score = 276 bits (707), Expect = 7e-79 Identities = 163/431 (37%), Positives = 243/431 (56%), Gaps = 21/431 (4%) Query: 19 DHHLPPFTDYKQLNEKGARIITKAEGVYIWDSEGNKILDAMAGLWCVNVGYGREELVQAA 78 D + P++ +Q + R+I AEG Y D++G KI D ++GLWC G+ R E+ +A Sbjct: 18 DAYWLPYSANRQF-KSDPRLIVGAEGSYYIDADGRKIFDGLSGLWCCGAGHNRPEIAEAV 76 Query: 79 TRQMRELPFYNLFFQTAHPPVVELAKAIADVAPEGMNHVFFTGSGSEANDTVLRMVRHYW 138 +Q+REL Y FQ HP ELA+ I + P+G++HVF+T SGS+A DT L++ R YW Sbjct: 77 AKQLRELD-YAPAFQFGHPKAFELAERITQLTPKGLDHVFYTNSGSDAADTSLKIARAYW 135 Query: 139 ATKGQPQKKVVIGRWNGYHGSTVAGVSLGGMKA---LHEQGDFPIPGIVHIAQPYWYGEG 195 KG+P K +IGR GYHG G+SLGG+ A L QG H++ Sbjct: 136 RKKGKPTKTKLIGRAKGYHGVNFGGISLGGIGANRMLFGQGI----DADHLSHTLLKENL 191 Query: 196 GDMSPDEFGVWAAEQLEKKILEVGEENVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKY 255 E GV AE L + I N+AA I EP+ G+ GV+ PP Y ++REI ++ Sbjct: 192 FSRGMPERGVERAEDLLELIALHDASNIAAVIVEPMAGSAGVLPPPVGYLQRLREICDQH 251 Query: 256 DILFIADEVICGFGRTGEWFGSQYYGNAPDLMPIAKGLTSGYIPMGGVVVRDEIVEV-LN 314 +IL I DEVI GFGR G G++ +G PD+M +AK LT+G +PMG V+V+ EI + + Sbjct: 252 EILLIFDEVITGFGRMGSNTGAEEFGVTPDMMNVAKQLTNGAVPMGAVIVQREIYQTFME 311 Query: 315 QGGEFY-----HGFTYSGHPVAAAVALENIRILREEKIIEKVKAETAPYLQKRWQELADH 369 QGG Y HG+TYSGHPVA A AL ++ IL+ ++++++V+ E +P + L Sbjct: 312 QGGPDYAIELPHGYTYSGHPVACAAALASLDILQNDRLVDRVR-EMSPIFENALHGLKGT 370 Query: 370 PLVGEARGVGMVAALELVKNKKTRERFTDKGVGMLCREHCFRNGLIMRAVGDTMIISPPL 429 V + R GM AL+ ++++ + M C+ G +R GDT+ + P Sbjct: 371 RYVTDIRNYGMAGALQ-IESRPGEPARRPYEIAM----KCWEKGFYVRYGGDTIQLGMPF 425 Query: 430 VIDPSQIDELI 440 +++ +ID +I Sbjct: 426 IVEREEIDNVI 436 Lambda K H 0.320 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 569 Number of extensions: 37 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 456 Length of database: 447 Length adjustment: 33 Effective length of query: 423 Effective length of database: 414 Effective search space: 175122 Effective search space used: 175122 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory