Align ABC transporter permease (characterized, see rationale)
to candidate WP_090272110.1 BLU11_RS03765 high-affinity branched-chain amino acid ABC transporter permease LivH
Query= uniprot:A0A165KC95 (309 letters) >NCBI__GCF_900105005.1:WP_090272110.1 Length = 308 Score = 244 bits (623), Expect = 2e-69 Identities = 136/307 (44%), Positives = 197/307 (64%), Gaps = 21/307 (6%) Query: 4 LLQQIINGLVLGSMYALIALGYTMVYGIIQLINFAHGEVLMIGALTSWSCIGMMQGAMPG 63 LLQQ++NGL +GS YALIA+GYTMVYGII +INFAHGEV MIG+ ++ + + A+ G Sbjct: 8 LLQQLLNGLTVGSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYIAFIVLAAL--ALLG 65 Query: 64 APGWVILLLAT-IIACVVAATLNFVIEKVAYRPLRSSPRLAPLITAIGMSILLQTLAMII 122 +L++A +++ +V + + IE+VAYRPLR RL PLI+AIGMSI LQ L + Sbjct: 66 IESLPLLIIAALVVSMIVTSAYGYSIERVAYRPLRGGNRLIPLISAIGMSIFLQNLVRLA 125 Query: 123 WKPNYKPYPTML-------PSSPFEIGGAFITPTQILILGVTAVALASLVYLVNHTNLGR 175 P ++ P++ F A ++ QI+I VT +++ L + + +GR Sbjct: 126 QGSRDIAMPNLVRGGIDIGPATGFH---ATLSYMQIIIFVVTLISMTLLTLFITRSRMGR 182 Query: 176 AMRATAENPRVASLMGVKPDMVISATFIIGAVLAAIAGIMYASNYGTAQHTMGFLPGLKA 235 A RA AE+ ++ +L+G+ + +I+ TFIIGA LAA+AG++ YG +GF+ GLKA Sbjct: 183 ACRACAEDLKMTNLLGINTNSIIALTFIIGAALAAVAGVLLGMYYGVINPYIGFMAGLKA 242 Query: 236 FTAAVFGGIGNLAGAVVGGILLGLIEAIGSGYIGTLTGGLLGSHYTDIFAFIVLIIILTL 295 FTAAV GGIG++ GAV+GG+LLG+ EA+ +GY Y D+ AF +LI+IL Sbjct: 243 FTAAVLGGIGSIPGAVLGGLLLGVAEAMTAGY--------FSGEYKDVVAFSLLILILLF 294 Query: 296 RPSGLLG 302 RPSG+LG Sbjct: 295 RPSGILG 301 Lambda K H 0.327 0.142 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 308 Length adjustment: 27 Effective length of query: 282 Effective length of database: 281 Effective search space: 79242 Effective search space used: 79242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory