Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_090272717.1 BLU11_RS07240 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_900105005.1:WP_090272717.1 Length = 357 Score = 218 bits (554), Expect = 3e-61 Identities = 122/294 (41%), Positives = 177/294 (60%), Gaps = 17/294 (5%) Query: 8 NIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYIDDK 67 N+ K Y + V+NF+LDI EF+ +GPSG GK+T L M+AG E T G + +D + Sbjct: 10 NVQKSY-DGDTLVVKNFSLDISKGEFLTMLGPSGSGKTTCLMMLAGFETPTSGEIRLDGQ 68 Query: 68 LMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAAEILGLTE 127 ++N +P R I MVFQNYAL+PHM++ EN+A+ L +RK K +I +RV+ + +++ + + Sbjct: 69 MINKMAPHKRGIGMVFQNYALFPHMTIAENLAYPLTVRKMPKAEIEQRVNTSLDMVEMRD 128 Query: 128 FLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGA 187 R P LSGGQ+QR+A+ RA++ + K+ LMDEPL LD LR M+ EI ++H R+G Sbjct: 129 KKNRTPGQLSGGQKQRIALARALIFEPKLVLMDEPLGALDKNLREQMQYEIKRLHERLGI 188 Query: 188 TTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVAGFIG 247 T +YVTHDQTEA+T++DRI + G ++Q+ +P LY EPA FVA FIG Sbjct: 189 TAVYVTHDQTEALTMSDRIAVFDD----------GIVQQVASPSVLYEEPATAFVANFIG 238 Query: 248 SPAMNFFEVTVEKERLVNQDGLSLALPQG-QEKILEEKGYLGKKVTLGIRPEDI 300 N F + RL N + +P + + G G V L +RPE I Sbjct: 239 E--NNAFAGRL--GRLAN-GKRQIEMPNSFIQTEHDSAGQEGSPVVLSVRPERI 287 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 357 Length adjustment: 30 Effective length of query: 347 Effective length of database: 327 Effective search space: 113469 Effective search space used: 113469 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory