Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate WP_090276009.1 BLU11_RS18855 sulfate ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >NCBI__GCF_900105005.1:WP_090276009.1 Length = 374 Score = 183 bits (464), Expect = 8e-51 Identities = 108/294 (36%), Positives = 171/294 (58%), Gaps = 30/294 (10%) Query: 16 AKHY----SVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEGNLYIDDKLMND 71 +KH+ +++N +LDI D + + +GPSG GK+T LR+IAGLE G + + + + Sbjct: 9 SKHFGSFQALKNISLDIPDGQLVGLLGPSGSGKTTLLRIIAGLETADSGRILFHGEDVTN 68 Query: 72 ASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKD----DINKRVHEAAEILGLTE 127 ++R + VFQ+YAL+ HM+V +N+AFGL++ ++ +I KRV E++ L + Sbjct: 69 LHVRERKVGFVFQHYALFRHMTVAQNVAFGLEVLPARERPPAAEIRKRVDMLLEMVQLGQ 128 Query: 128 FLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAKIHRRIGA 187 ER PA LSGGQ+QR+A+ RA+ ++ L+DEP LDAK+R +R + +H Sbjct: 129 LAERYPAQLSGGQKQRIALARALSMKPQILLLDEPFGALDAKVRKDLRRWLRALHAEFHF 188 Query: 188 TTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANKFVAGFIG 247 T+++VTHDQ EA+ L+D++ +MSA GRIEQ+ PQ+LY EP ++FV F+G Sbjct: 189 TSVFVTHDQEEALELSDQVAVMSA----------GRIEQVDRPQQLYAEPTSRFVFDFLG 238 Query: 248 SPAMNFFEVTVEKERLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGIRPEDIS 301 +N F +Q G SL+ QG + + L +RP ++S Sbjct: 239 H--VNVF--------AGDQQGSSLS--QGDAWVRLPANAAEQAAQLYMRPHEVS 280 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 374 Length adjustment: 30 Effective length of query: 347 Effective length of database: 344 Effective search space: 119368 Effective search space used: 119368 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory