Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate WP_090274680.1 BLU11_RS14815 polyamine ABC transporter ATP-binding protein
Query= uniprot:P40735 (281 letters) >NCBI__GCF_900105005.1:WP_090274680.1 Length = 378 Score = 121 bits (304), Expect = 2e-32 Identities = 80/210 (38%), Positives = 123/210 (58%), Gaps = 6/210 (2%) Query: 24 ALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRK 83 A+D V+L + GE A++G +GSGKSTL R L G P G + + G +T ++ ++ Sbjct: 35 AVDDVTLTINRGEIFALLGGSGSGKSTLLRILAGFETPSEGRVLLDGQNIT--ALPPHKR 92 Query: 84 KIGMVFQNPDNQFVGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNMQDFLDQEPHHL 143 I M+FQ+ F TV ++AFGL+ + + E+ ERV +K V+M + ++PH L Sbjct: 93 PINMMFQSYA-LFPHMTVEQNIAFGLKQDKLSNTEISERVAEMLKLVHMAKYAKRKPHQL 151 Query: 144 SGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEV-LETVRHLKEQGMATVISITHD 202 SGGQ+QRVA+A +A RP +++LDE LD R ++ LE V ++ G+ T I +THD Sbjct: 152 SGGQRQRVALARSLAKRPKLLLLDEPMGALDKKLRSQMQLELVEIIERVGV-TCIMVTHD 210 Query: 203 LNEA-AKADRIIVMNGGKKYAEGPPEEIFK 231 EA A RI +M+ G G P +I++ Sbjct: 211 QEEAMTMAQRIAIMDQGWIVQVGTPMDIYE 240 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 237 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 378 Length adjustment: 28 Effective length of query: 253 Effective length of database: 350 Effective search space: 88550 Effective search space used: 88550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory