Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 1/3) (EC 1.3.1.110) (characterized)
to candidate WP_091371299.1 BLU33_RS08595 FAD-binding protein
Query= BRENDA::H6LBS1 (466 letters) >NCBI__GCF_900105165.1:WP_091371299.1 Length = 465 Score = 314 bits (804), Expect = 5e-90 Identities = 167/465 (35%), Positives = 260/465 (55%), Gaps = 3/465 (0%) Query: 1 MNYKKVEASDIAAIKELIPAERVFVGTEIGEDFSHDELGSIHSYPEVLIKVTSTEEVSKI 60 M + K++ + + AI ++ + V + E +SHDE + YPEV++K S +E+S + Sbjct: 1 MAFNKIDDNILQAIIAIVGNDSVITSRDDMERYSHDETEDLSYYPEVVVKPRSAKEISAL 60 Query: 61 MKYAYEHNIPVVVRGSGTGLVGACVPLFGGIMLETTLMNNILELDTENLTVTVEPGVLLM 120 +K EH IPV RG+GTGL G + + GG+++ + IL +D +NL TVEPGV+ Sbjct: 61 LKLCNEHMIPVTPRGAGTGLSGGALSVMGGLLISMERFDQILNIDEQNLQATVEPGVITE 120 Query: 121 ELSKFVEENDLFYPPDPGEK-SATIAGNISTNAGGMRAVKYGVTRDYVRGLTVVLANGEI 179 V E L YP DP K S I GN+S +GG R VKYG R+Y+ L VVL +GEI Sbjct: 121 VFMNAVAEKGLLYPVDPASKGSCFIGGNVSHGSGGPRVVKYGTIREYILNLEVVLPSGEI 180 Query: 180 IELGGKIVKNSSGYSLKDLVIGSEGTLCVITKAILKLLPLPKMTLSLLIPFENISDAAGI 239 I G +K +SGY+L L+IG+EGTL VITK + KL+P P +L F + A Sbjct: 181 IWTGANTLKYASGYNLTQLMIGAEGTLGVITKIVTKLIPHPTNDALMLASFPSNESACAA 240 Query: 240 VPKIIKSKAIPTAIEFMERQTILFAEDFLGKKFP-DSSSNAYILLTFDGNTKEQVEAEYE 298 V I ++ +P+A+E+MER+ + + + G +F A++L+ DG E + AE E Sbjct: 241 VSAIFRAGIVPSAVEYMERKCFEWVKAYNGVQFDLKDEDAAFLLIEVDGTDNEVIFAECE 300 Query: 299 TVANLCLAEGAKDVYIVDTVERKDSVWSARGAFLEAIKASTTEMDECDVVVPRNRIAEFI 358 + + + G KDV D+ +K +W R E++K ++ E D+VVPR + + + Sbjct: 301 KINQVLESFGCKDVLFADSAAKKAELWHIRRTIGESVKINSVYKKE-DMVVPRATLPQLV 359 Query: 359 EFTHDLAKEMDVRIPSFGHAGDGNLHIYVCRDELCQADWEAKLAEAMDRMYAKALTFEGL 418 + ++ + FGHAGDGNLH+ + + + ADW KL + ++ ++ G Sbjct: 360 KGIKEIGNKYGFDSVCFGHAGDGNLHLNIIQGSMSNADWNDKLNTGIAEIFELTVSLGGT 419 Query: 419 VSGEHGIGYAKRKYLLNDFGTEHLALMAGIKQTFDPKNLLNPKKV 463 +SGEHGIG +++++ + H L GIK+ FD N+LNP K+ Sbjct: 420 ISGEHGIGLVQKEFMPIKYTNVHFELWRGIKKVFDKNNILNPGKI 464 Lambda K H 0.318 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 535 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 466 Length of database: 465 Length adjustment: 33 Effective length of query: 433 Effective length of database: 432 Effective search space: 187056 Effective search space used: 187056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory