Align 2-dehydro-3-deoxy-phosphogluconate aldolase (EC 4.1.2.14) (characterized)
to candidate WP_091373342.1 BLU33_RS12875 bifunctional 4-hydroxy-2-oxoglutarate aldolase/2-dehydro-3-deoxy-phosphogluconate aldolase
Query= reanno::Pedo557:CA265_RS19860 (219 letters) >NCBI__GCF_900105165.1:WP_091373342.1 Length = 219 Score = 283 bits (724), Expect = 2e-81 Identities = 133/219 (60%), Positives = 179/219 (81%) Query: 1 MSNKHKILDAILEQGMLPLFYQDSESGSVEILRTLYKAGVRVFEYTNRGKSALPNFKKLK 60 MSN IL I+ QG+LPLF+ + S+++ RTLY+AGVR EYTNRG +AL NFK LK Sbjct: 1 MSNHETILAGIITQGILPLFFYEDAEVSLQVTRTLYRAGVRAIEYTNRGPAALENFKVLK 60 Query: 61 EIRDAEMPDLYLGIGTIKTPADANAFIEAGTDFIVAPIVNPAVAEIANKIGMLWIPGCMT 120 + + +EMP+L+LGIGTIK+ +A F+ AG DFIVAPIVNPAVA++A++ G+LW PGCMT Sbjct: 61 KAQQSEMPELHLGIGTIKSEQEARDFVAAGADFIVAPIVNPAVAKVAHEHGILWCPGCMT 120 Query: 121 PTEISVAQEHKAMLIKIFPANILGPEFISSIKDLFAGQLFMPTGGVEINADNLKTWFKSG 180 PTEI AQ++ A LIK+FPANILG F+SSIK+LF GQLFMPTGGVE++ +N+ WFK+G Sbjct: 121 PTEIYTAQQNGAALIKLFPANILGHSFLSSIKELFPGQLFMPTGGVELHIENISNWFKAG 180 Query: 181 VCAVGMGSKLISKDVMSKGLYEELFDNTKLALDLIQQSK 219 VCAVG+GSKLI+KDV++KGLY++L+++T A++L++ +K Sbjct: 181 VCAVGLGSKLITKDVLTKGLYDQLYNDTIKAMELVKAAK 219 Lambda K H 0.319 0.137 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 219 Length of database: 219 Length adjustment: 22 Effective length of query: 197 Effective length of database: 197 Effective search space: 38809 Effective search space used: 38809 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory