Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate WP_091377242.1 BLU33_RS19840 ABC transporter ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >NCBI__GCF_900105165.1:WP_091377242.1 Length = 318 Score = 143 bits (360), Expect = 7e-39 Identities = 92/249 (36%), Positives = 143/249 (57%), Gaps = 7/249 (2%) Query: 4 IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63 I V+++SK F GKV A+D+++ + E +LG SG GKTT +++I L P+ G+++ Sbjct: 2 IKVEHLSKHF--GKVKAVDDISFEVAEHETLVLLGTSGCGKTTTLKMINRLIEPTHGKIF 59 Query: 64 FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEE 123 +++ + ++ R IG V Q L+P+ T ENIA +K ++I+ RV E Sbjct: 60 INNKNILDQQPEVLR---RGIGYVLQNNGLFPHYTVGENIAIVPQLLKWDVKKIQHRVSE 116 Query: 124 VAKILDIHH-VLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARAL 182 + + L + + LN +P ELSGGQQQRV LARALV +P +LL+DEPF LD + A Sbjct: 117 LLEKLHLSNDYLNVYPNELSGGQQQRVGLARALVANPPVLLMDEPFGALDNVTKAKIHAE 176 Query: 183 VKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIG 242 K + T+++V+HD + F + DR+ ++ GK+VQ G P +L P + V + Sbjct: 177 FKALDELKRKTIIMVTHDVQEAFELGDRICLMDAGKIVQTGVPTELLFKPKNNFVRDFLN 236 Query: 243 EIN-ELEGK 250 E ELE K Sbjct: 237 EQRLELEFK 245 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 274 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 318 Length adjustment: 28 Effective length of query: 325 Effective length of database: 290 Effective search space: 94250 Effective search space used: 94250 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory