Align Inositol transport system ATP-binding protein (characterized)
to candidate WP_091380759.1 BLU33_RS17430 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >NCBI__GCF_900105165.1:WP_091380759.1 Length = 572 Score = 90.1 bits (222), Expect = 9e-23 Identities = 78/235 (33%), Positives = 114/235 (48%), Gaps = 23/235 (9%) Query: 26 VSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILFEGQPLHFADPRDAIAAGIA 85 +S + PGE L+G+NGAGK+T +K +S ++ PT+G IL EG L D D + + Sbjct: 346 LSFTLHPGEKLALVGENGAGKTTLVKLLSRLYDPTEGRILLEGIDLKEYDLAD-LRLNVG 404 Query: 86 TVHQHLAMIPLMSVSRNFFMGNEPIRKIGPLKLFDHDYANRITMEEMRKMGINLRGP-DQ 144 + Q MS ++N +GN ++ PL N + L G DQ Sbjct: 405 IIFQDYLRYQ-MSFAQNIAVGNINQKENRPL------IVNSAKQSLADILAAKLPGQYDQ 457 Query: 145 AVG-------TLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTANVLATIDKVRKQ 197 +G LSGGE Q VA+ARA A++LILDEPTSAL R NV ++ K Sbjct: 458 QLGKRFADGVELSGGEWQKVALARAYMRDAQLLILDEPTSALDARAEYNVFERFAELTK- 516 Query: 198 GVAVVFITHNVRHALAVGDRFTVLNRGKTLGTAQRGDISAE-----ELQDMMAGG 247 G + V I+H + + DR VL +G+ + ++ + EL D+ A G Sbjct: 517 GKSAVLISHRF-STVRMADRILVLEKGELVEIGSHEELLIKGGRYAELFDLQAMG 570 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 572 Length adjustment: 30 Effective length of query: 231 Effective length of database: 542 Effective search space: 125202 Effective search space used: 125202 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory