Align Putative PTS system sugar phosphotransferase component IIA (characterized, see rationale)
to candidate WP_091292429.1 BLV57_RS24335 PTS glucose transporter subunit IIA
Query= uniprot:Q9KZP2 (149 letters) >NCBI__GCF_900107045.1:WP_091292429.1 Length = 152 Score = 159 bits (403), Expect = 1e-44 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 1/146 (0%) Query: 4 VSSPLAGRAIGLAAVPDPVFSGAMVGPGTAIDPVREPSEAVAPVDGVIVSLHPHAFVVVD 63 + SP+ G + + VPDPVF+ +MVGPG A+ P +AVAP+DG +V+LHPHA+VV Sbjct: 5 ILSPVNGTTVAMTEVPDPVFAESMVGPGVAVQPSGGRQDAVAPIDGTVVTLHPHAYVVAA 64 Query: 64 ESG-HGVLTHLGIDTVQLNGEGFELLVNKGDTVVRGQGVVRWDPAAVEAAGKSPICPIVA 122 G H VL HLGIDTV+ GEGF L V KG+TV GQ VV WDP AV AAG SP+ P+VA Sbjct: 65 ADGKHAVLVHLGIDTVKQKGEGFTLHVVKGETVRAGQPVVGWDPEAVTAAGYSPVVPVVA 124 Query: 123 LEATAEALADLREDGDVKAGESLFLW 148 L+ATA+AL+ + V AG+ +F W Sbjct: 125 LDATADALSGVTAGATVTAGDPVFSW 150 Lambda K H 0.316 0.136 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 149 Length of database: 152 Length adjustment: 16 Effective length of query: 133 Effective length of database: 136 Effective search space: 18088 Effective search space used: 18088 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 42 (20.8 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory