Align D/L-lactic acid transporter; Lactate racemization operon protein LarD; Lactic acid channel (characterized)
to candidate WP_091211508.1 BMX50_RS15860 aquaporin family protein
Query= SwissProt::F9UST3 (238 letters) >NCBI__GCF_900110105.1:WP_091211508.1 Length = 243 Score = 187 bits (475), Expect = 2e-52 Identities = 103/235 (43%), Positives = 136/235 (57%), Gaps = 16/235 (6%) Query: 6 IAEFMGTALMIIFGVGVHCSSVLKGTKYRGSGHIFAITTWGFGISVALFIFG---NVCIN 62 +AE +GT L+I+ G GV + VLK TK G I T WG + V + + G +N Sbjct: 5 VAELIGTMLIILLGDGVVANVVLKDTKGNNGGWIVITTAWGLAVFVGVVVAGPYSGAHLN 64 Query: 63 PAMVLAQCLLGNIAWSLFIPYSVAEVLGGVVGSVIVWIMYADHFKASTDEISPITIRNLF 122 PA+ LA + G AW+ IPY +A+ G +G+ +VWIMY DHFK + D P +I +F Sbjct: 65 PAVTLALAIAGKFAWANVIPYIIAQFAGACIGAFLVWIMYYDHFKRTND---PASILAVF 121 Query: 123 CTAPAVRNLPRNFFVELFDTFIFISGILAISEIK-TPGIVPIGVG--------LLVWAIG 173 CT PAVRN N E+ F+ + I I+ + TP P+G+G LVW IG Sbjct: 122 CTGPAVRNYVSNIASEVIGAFVLLFTIFYIAGAEITPAKTPVGLGSIGAIPVAFLVWVIG 181 Query: 174 MGLGGPTGFAMNLARDMGPRIAHAILPIANKADSDWQYGIIVPGIAPFVGAAIAA 228 + LGG TG+A+N ARD+GPR H +LPI K SDW Y I P IAP VGA+IAA Sbjct: 182 LSLGGTTGYAINPARDLGPRFMHMLLPIKGKGTSDWAYAWI-PVIAPLVGASIAA 235 Lambda K H 0.330 0.145 0.470 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 251 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 238 Length of database: 243 Length adjustment: 23 Effective length of query: 215 Effective length of database: 220 Effective search space: 47300 Effective search space used: 47300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory