Align TM1747, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_092686122.1 BMY71_RS21640 ABC transporter permease
Query= TCDB::Q9X269 (341 letters) >NCBI__GCF_900110435.1:WP_092686122.1 Length = 313 Score = 200 bits (509), Expect = 3e-56 Identities = 108/323 (33%), Positives = 183/323 (56%), Gaps = 20/323 (6%) Query: 25 LKFLLKRLLTIAISMVVVIVITYVLMWLAPGNFFELQRVRDAIARVTTPDDPAYQATLKG 84 L +L++R+L M VV ++ ++L+ L PG+ D A L Sbjct: 2 LGYLIRRILAAVPVMGVVALVVFLLLRLTPGD-----------PAAILAGDNASPEQLAR 50 Query: 85 FEERYGLNNPLWKQILMYLKGAVVFKFGPSFSDPARNIEDLIKEKFPITFTLALSSILFA 144 E GLN PL+ Q ++ + G S ++ +I ++ T ++A+S+I+ + Sbjct: 51 IRETLGLNEPLYTQFFSWVGKLLQGDLGVSLISQVPVLQ-MISQRIEPTLSIAISTIILS 109 Query: 145 LVVGVPLGILAALKKNTWIDYTAMTVSVIGVAIPSYVVAVFLILIFSIYLGWLPTSGWEG 204 ++V VPLG++AA K TWID M +SVIG ++P +V+ LI IF+I L W P G+ Sbjct: 110 IIVAVPLGVIAAWKHGTWIDRFVMGLSVIGFSVPVFVIGYMLIQIFAIELRWFPVQGFRP 169 Query: 205 I--------RTKILPTIALALGPLASVARFTRVSLLDTLNQDFIRTAYAKGGDDRTVIMK 256 + +LPT+ L+ +A +AR TR ++LD L +D++RTA AKG + V+++ Sbjct: 170 LARGFGPYFERLVLPTLTLSFIYIALIARMTRAAMLDVLGEDYVRTARAKGITETRVLLR 229 Query: 257 HALRPSMIPLVTIVGPQMAYLMVGTVWVENIFRIPGLGQLFANAAVTRDYPLLVTSTFIL 316 HALR + +P++T++G A L+ G V E++F +PG+G+L +A + RDYP++ + Sbjct: 230 HALRNAAVPVITVIGTGFALLISGVVVTESVFNLPGIGRLTVDAVLARDYPVIQGMILLT 289 Query: 317 ALTVMIMNLIVDVLYAILDPRIK 339 + + +NL++DV Y +LDPRI+ Sbjct: 290 SGIYVAVNLLIDVAYTLLDPRIR 312 Lambda K H 0.328 0.143 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 320 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 313 Length adjustment: 28 Effective length of query: 313 Effective length of database: 285 Effective search space: 89205 Effective search space used: 89205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory