Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate WP_092683293.1 BMY71_RS09320 ATP-binding cassette domain-containing protein
Query= TCDB::Q9X272 (328 letters) >NCBI__GCF_900110435.1:WP_092683293.1 Length = 324 Score = 265 bits (676), Expect = 1e-75 Identities = 147/324 (45%), Positives = 207/324 (63%), Gaps = 15/324 (4%) Query: 8 IKMKPLLQTVDLKK-----YFPQGK-RILKAVDGISIEIKEGETLGLVGESGCGKSTLGR 61 ++++ L Q D+ K GK LKAVDG+S EI GET LVGESG GK+T+ R Sbjct: 6 VEVRHLRQVFDVSKPWLNRVIEGGKPEYLKAVDGVSFEIARGETFALVGESGSGKTTVAR 65 Query: 62 TILKLLRPDGGKIFFEGKDITNLNDK-EMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDP 120 ++ LL+P G + +G +++ + R+++Q+IFQDP SLNP+M V II +P Sbjct: 66 MVVGLLQPTSGHVTIDGVSMSDTAQAGARRKLRRRIQMIFQDPYASLNPRMRVDAIIAEP 125 Query: 121 L-IIHKIGTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIV 179 + I + R RV ELL +VG+ + FPH+FSGGQ+QRI IARALA FIV Sbjct: 126 IRAFDLIQGSDDIRGRVGELLQLVGLHPDDGLKFPHQFSGGQRQRIAIARALASEADFIV 185 Query: 180 CDEPVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYG 239 CDEP SALDVS+QAQI++L+ ++Q ++G++YLFI+HNLAVV H++ ++ VMYLG+IVE Sbjct: 186 CDEPTSALDVSVQAQILNLMRDLQDRLGLTYLFISHNLAVVRHMASRIGVMYLGRIVEIA 245 Query: 240 DVDKIFLNPIHPYTRALLKSVPKIPWDGQKQRFYSLKGELPSPIDLPKGCRFQTRCTEKK 299 + ++F P PYTR LL +VP + G+++ +KGE+P+PID P GC F RC E Sbjct: 246 EGRELFSRPQMPYTRMLLGAVPDLAMSGRQR--IPVKGEIPNPIDPPTGCAFHPRCPEAF 303 Query: 300 AICFEKEPELTEVEKNHFVSCHLV 323 C + PEL + V+CH V Sbjct: 304 DRCRAERPELID-----GVACHAV 322 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 327 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 324 Length adjustment: 28 Effective length of query: 300 Effective length of database: 296 Effective search space: 88800 Effective search space used: 88800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory