GapMind for catabolism of small carbon sources

 

Protein WP_093427144.1 in Thiohalospira halophila HL 3

Annotation: NCBI__GCF_900112605.1:WP_093427144.1

Length: 371 amino acids

Source: GCF_900112605.1 in NCBI

Candidate for 73 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
trehalose catabolism thuK med Trehalose import ATP-binding protein SugC; EC 7.5.2.- (characterized) 42% 71% 202.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-fucose catabolism SM_b21106 med ABC transporter for L-Fucose, ATPase component (characterized) 42% 75% 197.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 37% 94% 215.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-arabinose catabolism xacJ lo Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale) 39% 77% 211.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 209.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 209.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 209.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 209.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 209.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 37% 95% 209.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-mannitol catabolism mtlK lo SmoK aka POLK, component of Hexitol (glucitol; mannitol) porter (characterized) 37% 95% 203 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
putrescine catabolism potA lo PotG aka B0855, component of Putrescine porter (characterized) 35% 89% 201.8 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism thuK lo Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 44% 66% 200.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 35% 95% 199.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 82% 199.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 39% 82% 199.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
sucrose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
trehalose catabolism aglK lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 92% 198 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
sucrose catabolism thuK lo ABC transporter (characterized, see rationale) 36% 96% 196.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 35% 97% 195.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 37% 94% 194.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-cellobiose catabolism msiK lo MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized) 36% 81% 193 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-cellobiose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 93% 190.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-galactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 93% 190.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-glucose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 93% 190.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
lactose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 93% 190.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 93% 190.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-mannose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 93% 190.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
sucrose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 93% 190.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
trehalose catabolism glcV lo monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized) 36% 93% 190.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism malK lo ABC-type maltose transporter (subunit 3/3) (EC 7.5.2.1) (characterized) 44% 65% 188.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 36% 89% 187.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 40% 75% 187.2 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism musK lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 41% 64% 186.4 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-glucosamine (chitosamine) catabolism SM_b21216 lo ABC transporter for D-Glucosamine, ATPase component (characterized) 35% 87% 183 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
trehalose catabolism malK lo MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized) 33% 97% 181 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 41% 66% 179.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism malK_Aa lo ABC-type maltose transporter (EC 7.5.2.1) (characterized) 34% 95% 179.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 37% 75% 179.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 33% 93% 174.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-maltose catabolism malK_Sm lo MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) 32% 96% 172.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-cellobiose catabolism SMc04256 lo ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized) 34% 98% 171 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 34% 92% 171 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 31% 97% 170.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-arabinose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 72% 167.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-fructose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 72% 167.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
sucrose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 72% 167.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-xylose catabolism araV lo AraV, component of Arabinose, fructose, xylose porter (characterized) 36% 72% 167.9 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-glutamate catabolism gltL lo GluA aka CGL1950, component of Glutamate porter (characterized) 35% 98% 149.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 33% 75% 149.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-glucosamine (chitosamine) catabolism AO353_21725 lo ABC transporter for D-Glucosamine, putative ATPase component (characterized) 35% 95% 147.5 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-proline catabolism opuBA lo BusAA, component of Uptake system for glycine-betaine (high affinity) and proline (low affinity) (OpuAA-OpuABC) or BusAA-ABC of Lactococcus lactis). BusAA, the ATPase subunit, has a C-terminal tandem cystathionine β-synthase (CBS) domain which is the cytoplasmic K+ sensor for osmotic stress (osmotic strength)while the BusABC subunit has the membrane and receptor domains fused to each other (Biemans-Oldehinkel et al., 2006; Mahmood et al., 2006; Gul et al. 2012). An N-terminal amphipathic α-helix of OpuA is necessary for high activity but is not critical for biogenesis or the ionic regulation of transport (characterized) 36% 57% 147.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-histidine catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 35% 88% 144.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 35% 88% 144.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 92% 137.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 92% 137.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 92% 137.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 92% 137.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 92% 137.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 92% 137.1 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 33% 94% 136.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 32% 99% 136.7 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 30% 93% 136.3 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 34% 96% 136 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-asparagine catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 31% 98% 123.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5
L-aspartate catabolism peb1C lo PEB1C, component of Uptake system for glutamate and aspartate (characterized) 31% 98% 123.6 FutC aka SLL1878, component of Ferric iron (Fe3+) porter 45% 263.5

Sequence Analysis Tools

View WP_093427144.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MLEIDGLNVTYGDEIAVQDVSLRVDEGEIVTLLGPTGCGKTTTLRVVAGLVRPSSGTVRI
SGQTVNSDTAFVPPEQRRTGLVFQDFALFPHLTVAENVGFRLGRGAGVDHWLDWLGLGDQ
RDAYPEELSGGQKQRVALARCLAHHPEMVLLDEPLSNLDAALKDSLRWEIRAALKEAGVP
AIWVTHDQAEALSIGDRVGVMRHGRLEQIAEPETCFRDPASRFVAEFLGEASFLPGRTRE
GSVATPIGPATGHGAEGAVEALVRPDDLDLRADEPGNGVVAWSRYEGATRLFAVDLAGGS
RVRVRTNHEVHHEPGDRVTVTITANHGLALFPADHDVEELDWGETAAEPTPETHDGMPED
VVATGHIGSGG

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory