Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate WP_093428089.1 BM272_RS07150 glutamine--fructose-6-phosphate transaminase (isomerizing)
Query= reanno::Korea:Ga0059261_1644 (347 letters) >NCBI__GCF_900112605.1:WP_093428089.1 Length = 610 Score = 143 bits (360), Expect = 1e-38 Identities = 103/307 (33%), Positives = 159/307 (51%), Gaps = 21/307 (6%) Query: 55 ARGSSDHAATYAKYLIETLTGVPTASAALSVASLYDAPVAPGNGLCLAISQSGKSPDLLA 114 A G+S HA A+Y +E + GVP S ++ Y PV + L + ISQSG++ D LA Sbjct: 301 ACGTSYHAGMVARYWLEAVAGVP-CSVEVANEFRYRRPVVRPDTLVVTISQSGETADTLA 359 Query: 115 TVEH-QRKAGAFVVAMVNAEDSPLAALADIVIPLKAGPERSVAATKSYICSLAAIAALVA 173 + + + G+ +A+ N +S L +++V+ +AGPE VA+TK++ L A+ L Sbjct: 360 ALRDIKARVGSRALAICNVPESSLVRESELVLMTRAGPEIGVASTKAFTTQLTALLLLTL 419 Query: 174 AWAQDEALET--------AVADLPAQLERAFALDWSAAVTALTGAS---GLFVLGRGYGY 222 A A+ L A+ +LP ++ERA L+ + A A LF LGRG Y Sbjct: 420 ALARRNGLPAEREAEYVAALEELPRRIERALELNDAIDALAADFADKHHSLF-LGRGPLY 478 Query: 223 GIAQEAALKFKETCALHAESFSAAEVRHGPMAIVGEAFHVLAFASSDRAGESVRETVAEF 282 +A E ALK KE +HAE++ A E++HGP+A+V V+A A +D E ++ + E Sbjct: 479 PVAMEGALKLKEISYIHAEAYPAGELKHGPLALVDGEMPVIAIAPNDDLLEKLKSNLQEV 538 Query: 283 RSRGAE-VLLADPAARQ------AGLPAIAAHPAIEPILIVQSFYKMANALALARGCDPD 335 R+RG V+ AD AA P +H I P++ +A +A+ +G D D Sbjct: 539 RARGGRLVVFADTAAGMDDGEGVRTFPLEHSHELIAPVVYTVPLQLLAYHVAVIKGTDVD 598 Query: 336 SPPHLNK 342 P +L K Sbjct: 599 QPRNLAK 605 Lambda K H 0.317 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 610 Length adjustment: 33 Effective length of query: 314 Effective length of database: 577 Effective search space: 181178 Effective search space used: 181178 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory