Align Succinylornithine transaminase; SOAT; EC 2.6.1.81; Succinylornithine aminotransferase (uncharacterized)
to candidate WP_093428323.1 BM272_RS08315 adenosylmethionine--8-amino-7-oxononanoate transaminase
Query= curated2:Q3Z295 (406 letters) >NCBI__GCF_900112605.1:WP_093428323.1 Length = 449 Score = 177 bits (450), Expect = 4e-49 Identities = 129/408 (31%), Positives = 203/408 (49%), Gaps = 46/408 (11%) Query: 22 PFIPV-RGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTG-NGYT 79 P +P+ RG+G L D G+E+ID VN GHA+P + + EQ + H G++ Sbjct: 28 PPVPIKRGKGVWLEDYDGREFIDAVSSWWVNLFGHANPRINARIREQMEQLEHVILAGFS 87 Query: 80 NEPVLRLAKKLIDAT--FADRVFFCNSGAEANEAALKLARKFAHDRYGSHKSGIVAFKNA 137 +EPV+ L+++L+D R F+ ++G+ A E ALK++ + +R S K+ VA + Sbjct: 88 HEPVVELSERLVDLAPEGLTRAFYADNGSSAIEVALKMSFHYWLNRGQSQKTRFVALTGS 147 Query: 138 FHGRTLFTVSAGGQPAYSQDFAPL--------PPDIRHAA------------YNDINSAS 177 +HG TL +S G P Y + + PL PD H + ++ Sbjct: 148 YHGETLGALSVGHVPLYRETYGPLLLEAIHAPSPDCYHREPGEDCAEYAERQFAEMERIL 207 Query: 178 ALIDDATCAVIVEP-IQGEGGVVPASNAFLQGLRELCDRHNALLIFDEVQTGVGRTGELY 236 A D CAV+VEP +Q GG+ +L+ LRE CDR+ LI DE+ G GRTG ++ Sbjct: 208 AENADEVCAVVVEPLVQCVGGMRMHDPVYLERLREACDRYGIHLIADEIAVGFGRTGTMF 267 Query: 237 AYMHYGVTPDLLTTAKALGGGF-PVGALLTTEE--CA-----SVMTVGTHGTTYGGNPLA 288 A G+TPD + +K L G+ P+ A LTTEE CA + +T H ++ GNPL Sbjct: 268 ACEQAGITPDFMCLSKGLTAGYLPLAATLTTEEVYCAFYDDFNNLTAFLHSHSFTGNPLG 327 Query: 289 SAVAGKVLELINTPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYA 348 A A L++ E++ +++ + E + +N + +EVR G+++ ++ D A Sbjct: 328 CAAALATLDIFAEDEVIESNRRKAEVMGEAMAPLND-HPKVAEVRQTGMILAAEMSPDPA 386 Query: 349 GQAKQISQEAAKAGVMVLIAG----------GNVVRFAPALNVSEEEV 386 + QE + G+ V G GNVV P +SEEE+ Sbjct: 387 NRTAYPWQE--RRGLHVYRHGLENRALLRPLGNVVYLMPPYVISEEEI 432 Lambda K H 0.319 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 457 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 449 Length adjustment: 32 Effective length of query: 374 Effective length of database: 417 Effective search space: 155958 Effective search space used: 155958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory