Align 5-aminovalerate transaminase (EC 2.6.1.48) (characterized)
to candidate WP_093427672.1 BM272_RS05075 aspartate aminotransferase family protein
Query= BRENDA::Q9I6M4 (426 letters) >NCBI__GCF_900112605.1:WP_093427672.1 Length = 394 Score = 228 bits (581), Expect = 3e-64 Identities = 148/414 (35%), Positives = 209/414 (50%), Gaps = 50/414 (12%) Query: 25 PVVAERAENSTVWDVEGREYIDFAGGIAVLNTGHLHPKVIAAVQEQLGKLSHTCFQVLAY 84 PV E + +WD EGREY+D GIAV GH HP V AAV +Q G+L HT Sbjct: 13 PVAFEEGRGARLWDTEGREYLDAIAGIAVCGLGHAHPAVTAAVCDQAGRLVHTSNLYR-- 70 Query: 85 EPYIELAEEIAKRVPGDFPKKT-LLVTSGSEAVENAVKIARAATGRAG-----VIAFTGA 138 I L E +A+R+ ++ SG+EA E A+KIAR + G VI G+ Sbjct: 71 ---IPLQERLAQRLTSAAGMESAFFCNSGAEANEAALKIARRTGSQRGIAEPKVIVMEGS 127 Query: 139 YHGRTMMTLGLTGKVV------PYSAGMGLMPGGIFRALAPCELHGVSEDDSIASIERIF 192 +HGRT+ TL TG P AG +P G + D++A++ Sbjct: 128 FHGRTLATLSATGNPAIQSGFEPLVAGFERVPWG--------------DADAVAAL---- 169 Query: 193 KNDAQPQDIAAIIIEPVQGEGGFYVNSKSFMQRLRALCDQHGILLIADEVQTGAGRTGTF 252 A +DI A+++EPV GEGG V ++ RLRA+CD LL+ DE+QTG GRTG Sbjct: 170 ---AGREDIVAVLVEPVTGEGGVGVPPADYLPRLRAICDDADWLLMVDEIQTGIGRTGDL 226 Query: 253 FATEQLGIVPDLTTFAKSVGGGFPISGVAGKAEIMDAIAPGGLGGTYAGSPIACAAALAV 312 FA+ G+ PD+ T AK +G G PI + + PG G T+ GSP+ A ALAV Sbjct: 227 FASLGAGVTPDVLTLAKGLGNGVPIGACLARGTAAGILGPGSHGTTFGGSPLVSATALAV 286 Query: 313 LKVFEEEKLLERSQAVGERLKAGLREIQAKHKVIGDVRGLGSMVAIELFEGGDTHKPAAE 372 L E E L R+ +G+R+ AGLR H + D+R G M+ +EL +P E Sbjct: 287 LDTMETEALPARAAELGDRIAAGLRARLGNHPAVADIRHRGLMIGVEL------DRPCKE 340 Query: 373 LVSKIVVRAREKGLILLSCGTYYNVIRFLMPVTIPDAQLEKGLAILAECFDELA 426 LV + ++GL++ T V+R L P+ + DA+ + +A+ + A Sbjct: 341 LVR----QGLDRGLLINV--TAERVVRLLPPLILSDAEADTITTTVADLIEAFA 388 Lambda K H 0.319 0.137 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 394 Length adjustment: 31 Effective length of query: 395 Effective length of database: 363 Effective search space: 143385 Effective search space used: 143385 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory