Align putrescine transport system permease protein PotH (characterized)
to candidate WP_093428528.1 BM272_RS09380 molybdate ABC transporter permease subunit
Query= CharProtDB::CH_088338 (317 letters) >NCBI__GCF_900112605.1:WP_093428528.1 Length = 228 Score = 85.1 bits (209), Expect = 1e-21 Identities = 56/163 (34%), Positives = 89/163 (54%), Gaps = 4/163 (2%) Query: 102 SLQVAAISTFCCLLIGYPLAWAVAHSKPSTRNILLLLVILPSWTSFLIRVYAWMGILKNN 161 +LQ+AA++T L++G PLAW +A ++ R ++ +V LP + + + +L + Sbjct: 16 TLQMAAVTTVILLILGTPLAWWLARTQRRWRGMVEAVVALPLVLPPTVLGFYLLVMLGPH 75 Query: 162 GVLNNFLLWLGVIDQPLTILHTNLAVYIGIVYAYVPFMVLPIYTALIRIDYSLVEAALDL 221 G + LW G + LT T L IG V +PF V P+ A ++ +EAA L Sbjct: 76 GPVG--ALWEGAGGERLTFTFTGLV--IGSVLYSLPFAVQPLMHAFEQLPRRPLEAAETL 131 Query: 222 GARPLKTFFTVIVPLTKGGIIAGSMLVFIPAVGEFVIPELLGG 264 GA PL FF+VI+PL++ G + + L F VGEF + ++GG Sbjct: 132 GAGPLDRFFSVILPLSRRGYLVATTLAFAHTVGEFGVVLMIGG 174 Lambda K H 0.328 0.144 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 317 Length of database: 228 Length adjustment: 25 Effective length of query: 292 Effective length of database: 203 Effective search space: 59276 Effective search space used: 59276 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory