Align fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_093427070.1 BM272_RS01980 hypothetical protein
Query= BRENDA::G4T023 (295 letters) >NCBI__GCF_900112605.1:WP_093427070.1 Length = 292 Score = 228 bits (581), Expect = 1e-64 Identities = 132/287 (45%), Positives = 168/287 (58%), Gaps = 6/287 (2%) Query: 7 TIFGEVLFDHFPDGSRVLGGAPFNVAWHLQAFRQEPHFISRVGQDATGDSVIAAMHKWGM 66 TIFGEVLFD F D + VLGGAPFNVAWHL+ Q +SR+G+D G + AM +W + Sbjct: 9 TIFGEVLFDEFGDHA-VLGGAPFNVAWHLRGLGQPARLVSRMGEDDYGRRIREAMARWDL 67 Query: 67 DMSGLQRDSRHPTGVVDIVIEQGEPAYTIVPEQAYDYID-EDELQDTDRPGLLYHGTLSL 125 D +GLQRD+ HPTG V + + GEP Y IV A+D I+ E + PGLLYHGTL+ Sbjct: 68 DDAGLQRDTEHPTGRVRVELAAGEPTYEIVTGVAWDAINAEAAVAAVGHPGLLYHGTLAA 127 Query: 126 RQPVSRAALDVLKDAHKGRIFMDVNLREPWWQKDQVLEWLGQADWVKLNHHELAALYPVS 185 R+ SRAAL+ L+ A IF+DVNLR PWW++ ++ L A W+KLN ELA L Sbjct: 128 REGRSRAALEALR-ARADGIFVDVNLRPPWWERHRMAALLDGARWIKLNGDELAELTGAD 186 Query: 186 GDLKADMRRFVELYRLQGLIVTSGKQGAFATDHQGVSCRVTPGEIAQVIDTVGAGDAFAS 245 A+ R + + G++VT G +GA GV R +A D VGAGDA A+ Sbjct: 187 DAAAAETLR--QRHGATGVLVTRGGEGAELFTESGVE-RAVAAPVAHFEDAVGAGDALAA 243 Query: 246 VMLLGLNLDWPLQITMERAQAFASAMVGQRGATVRDPVFYEPFIAAW 292 V LLG W + + R ASA+ G RGA DP FYEPF W Sbjct: 244 VFLLGELAGWEAGMRLRRGVELASAVCGLRGAVSDDPDFYEPFRKQW 290 Lambda K H 0.322 0.138 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 287 Number of extensions: 21 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 292 Length adjustment: 26 Effective length of query: 269 Effective length of database: 266 Effective search space: 71554 Effective search space used: 71554 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory