Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate WP_089751459.1 BMZ06_RS07620 iron ABC transporter permease
Query= SwissProt::P15030 (332 letters) >NCBI__GCF_900113125.1:WP_089751459.1 Length = 338 Score = 182 bits (462), Expect = 1e-50 Identities = 97/279 (34%), Positives = 164/279 (58%), Gaps = 3/279 (1%) Query: 53 EALVQNLRLPRSLVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAAL-AMALTSAL 111 + +++ R+ R+L+A+ +GASL++AG L+Q LT NP+ASP + G+N+GA +A + Sbjct: 56 QVIIRTSRITRTLIAMTVGASLSIAGALMQALTRNPLASPDIFGVNAGALFFIVAAATFF 115 Query: 112 SPTPIAGYSLSFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITL 171 S ++GY +I G GV+ +V G +++LAG A+SA + T+ L Sbjct: 116 SVESLSGYM--WIGFVGAGVAGTIVYLLGSMGEDGLSPIRIVLAGAAISALFISFTQGML 173 Query: 172 LLAEDHAYGIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTL 231 +L E + +WL+G V+ + +LP ++ A+ + + LN+L D A L Sbjct: 174 VLDEQRMQSVLFWLSGSVAGRELDILLPVLPFLLGAIVLSFFIGKPLNILMSGDDVAKNL 233 Query: 232 GVNLTRLRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGA 291 G N L+LVI + ++ L G V+VAG + FIGL+VPH+ + G + + ++P+S L GA Sbjct: 234 GQNTGLLKLVIGITIVFLAGGSVAVAGSIGFIGLVVPHIVKGITGPNYQWIIPISGLCGA 293 Query: 292 TLMLLADVLARALAFPGDLPAGAVLALIGSPCFVWLVRR 330 TL+L AD+ AR + P ++P G + AL G+P F+++ R+ Sbjct: 294 TLLLGADIAARLIIAPQEMPIGVMTALFGTPFFIYIARK 332 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 338 Length adjustment: 28 Effective length of query: 304 Effective length of database: 310 Effective search space: 94240 Effective search space used: 94240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory