GapMind for catabolism of small carbon sources

 

Protein WP_091518577.1 in Flavobacterium ummariense DS-12

Annotation: NCBI__GCF_900115115.1:WP_091518577.1

Length: 233 amino acids

Source: GCF_900115115.1 in NCBI

Candidate for 60 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-lysine catabolism hisP med Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale) 44% 89% 174.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-arginine catabolism artP med AotP aka PA0892, component of Arginine/ornithine (but not lysine) porter (characterized) 42% 93% 171 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-histidine catabolism BPHYT_RS24015 med ABC transporter related (characterized, see rationale) 42% 89% 169.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-citrulline catabolism AO353_03040 med ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized) 40% 93% 167.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-histidine catabolism hisP med Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 43% 91% 166.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-asparagine catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 41% 81% 163.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-aspartate catabolism bztD med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 41% 81% 163.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-glutamate catabolism gltL med BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 41% 81% 163.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-alanine catabolism Pf6N2E2_5405 med ABC transporter for D-Alanine, ATPase component (characterized) 40% 88% 161 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-asparagine catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 41% 92% 160.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-aspartate catabolism peb1C med PEB1C, component of Uptake system for glutamate and aspartate (characterized) 41% 92% 160.2 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-glucosamine (chitosamine) catabolism AO353_21725 med ABC transporter for D-glucosamine, ATPase component (characterized) 41% 86% 159.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-histidine catabolism aapP med ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized) 41% 83% 159.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-asparagine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 83% 158.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-aspartate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 83% 158.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-glutamate catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 83% 158.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-leucine catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 83% 158.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-proline catabolism aapP med AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 41% 83% 158.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-asparagine catabolism glnQ med Glutamine ABC transporter ATP-binding protein, component of Glutamine transporter, GlnQP. Takes up glutamine, asparagine and glutamate which compete for each other for binding both substrate and the transmembrane protein constituent of the system (Fulyani et al. 2015). Tandem substrate binding domains (SBDs) differ in substrate specificity and affinity, allowing cells to efficiently accumulate different amino acids via a single ABC transporter. Analysis revealed the roles of individual residues in determining the substrate affinity (characterized) 42% 88% 156.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-citrulline catabolism PS417_17605 lo ATP-binding cassette domain-containing protein; SubName: Full=Amino acid transporter; SubName: Full=Histidine ABC transporter ATP-binding protein; SubName: Full=Histidine transport system ATP-binding protein (characterized, see rationale) 40% 82% 159.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-histidine catabolism PA5503 lo Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized) 39% 65% 156 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-asparagine catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 40% 89% 151.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-aspartate catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 40% 89% 151.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-histidine catabolism Ac3H11_2560 lo ABC transporter for L-Histidine, ATPase component (characterized) 38% 88% 147.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-histidine catabolism bgtA lo BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized) 38% 90% 144.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 40% 84% 142.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 40% 84% 142.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-proline catabolism proV lo Glycine betaine/proline betaine transport system ATP-binding protein ProV (characterized) 36% 59% 141.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-histidine catabolism hutV lo ABC transporter for L-Histidine, ATPase component (characterized) 34% 93% 136 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-cellobiose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 65% 125.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-glucose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 65% 125.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
lactose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 65% 125.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 33% 59% 125.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-maltose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 65% 125.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
sucrose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 65% 125.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
trehalose catabolism gtsD lo Sugar ABC transporter ATP-binding protein (characterized, see rationale) 34% 65% 125.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-maltose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 33% 62% 123.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
sucrose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 33% 62% 123.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
trehalose catabolism thuK lo ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) 33% 62% 123.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 58% 122.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-proline catabolism hutV lo HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) 34% 87% 122.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 58% 122.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 36% 58% 122.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 60% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 36% 60% 119.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-mannose catabolism TM1750 lo TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 33% 73% 118.6 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-sorbitol (glucitol) catabolism mtlK lo ABC transporter for D-Sorbitol, ATPase component (characterized) 33% 66% 117.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 33% 55% 114.8 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-mannitol catabolism mtlK lo ABC transporter for D-Mannitol, D-Mannose, and D-Mannose, ATPase component (characterized) 32% 57% 114.4 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-mannose catabolism TM1749 lo TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) 30% 74% 112.1 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 32% 57% 110.5 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 32% 57% 105.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 31% 86% 101.7 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-alanine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 89% 85.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 89% 85.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-leucine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 89% 85.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-proline catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 89% 85.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-serine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 89% 85.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
L-threonine catabolism braG lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 31% 89% 85.9 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 31% 53% 81.3 Uncharacterized ABC transporter ATP-binding protein YknY; EC 7.6.2.- 54% 240.0

Sequence Analysis Tools

View WP_091518577.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIEIKDLHKSYQMGKNALHVLKGINFNVKEGEFVSIMGSSGSGKSTLLNIIGILDEADQG
SYTLDNVPIKNLNETIASQYRNKFLGFVFQSFNLINYKSALDNVALPLYYQGMARKERME
RSMHYLEKVGLANWAKHLPNELSGGQKQRVAIARALASDPKVLLADEPTGALDTKTSYEV
MDLIQQINDEGKTVLVVTHEPDIAEMTKRIVFLKDGQIESDKLVNQIRASQYV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory