GapMind for catabolism of small carbon sources

 

Protein WP_091519040.1 in Flavobacterium ummariense DS-12

Annotation: NCBI__GCF_900115115.1:WP_091519040.1

Length: 227 amino acids

Source: GCF_900115115.1 in NCBI

Candidate for 23 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-asparagine catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 37% 90% 144.8 Cell division ATP-binding protein FtsE 45% 189.1
L-aspartate catabolism aatP lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 37% 90% 144.8 Cell division ATP-binding protein FtsE 45% 189.1
L-glutamate catabolism gltL lo ABC transporter for L-asparagine and L-glutamate, ATPase component (characterized) 37% 90% 144.8 Cell division ATP-binding protein FtsE 45% 189.1
D-maltose catabolism malK lo Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized) 34% 58% 130.6 Cell division ATP-binding protein FtsE 45% 189.1
L-asparagine catabolism bgtA lo ATPase (characterized, see rationale) 35% 77% 127.1 Cell division ATP-binding protein FtsE 45% 189.1
L-aspartate catabolism bgtA lo ATPase (characterized, see rationale) 35% 77% 127.1 Cell division ATP-binding protein FtsE 45% 189.1
L-asparagine catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 76% 123.6 Cell division ATP-binding protein FtsE 45% 189.1
L-aspartate catabolism bztD lo BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) 35% 76% 123.6 Cell division ATP-binding protein FtsE 45% 189.1
D-alanine catabolism Pf6N2E2_5405 lo ABC transporter for D-Alanine, ATPase component (characterized) 35% 79% 122.1 Cell division ATP-binding protein FtsE 45% 189.1
L-asparagine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 78% 120.2 Cell division ATP-binding protein FtsE 45% 189.1
L-aspartate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 78% 120.2 Cell division ATP-binding protein FtsE 45% 189.1
L-glutamate catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 78% 120.2 Cell division ATP-binding protein FtsE 45% 189.1
L-histidine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 78% 120.2 Cell division ATP-binding protein FtsE 45% 189.1
L-leucine catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 78% 120.2 Cell division ATP-binding protein FtsE 45% 189.1
L-proline catabolism aapP lo AapP, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized) 34% 78% 120.2 Cell division ATP-binding protein FtsE 45% 189.1
xylitol catabolism Dshi_0546 lo ABC transporter for Xylitol, ATPase component (characterized) 33% 63% 120.2 Cell division ATP-binding protein FtsE 45% 189.1
L-arabinose catabolism xacK lo Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale) 31% 52% 114.4 Cell division ATP-binding protein FtsE 45% 189.1
L-tryptophan catabolism ecfA2 lo Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale) 32% 73% 108.6 Cell division ATP-binding protein FtsE 45% 189.1
glycerol catabolism glpS lo ABC transporter for Glycerol, ATPase component 1 (characterized) 33% 53% 95.1 Cell division ATP-binding protein FtsE 45% 189.1
L-isoleucine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 31% 82% 84.7 Cell division ATP-binding protein FtsE 45% 189.1
L-leucine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 31% 82% 84.7 Cell division ATP-binding protein FtsE 45% 189.1
L-phenylalanine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 31% 82% 84.7 Cell division ATP-binding protein FtsE 45% 189.1
L-valine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 31% 82% 84.7 Cell division ATP-binding protein FtsE 45% 189.1

Sequence Analysis Tools

View WP_091519040.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSASILKLHNATIFQDTEPILADVNIDIHKGEFIYLIGKTGSGKSSLMKTLYADLDLKDG
EGVIVDYDLRTLKQNDIPFLRRKLGIVFQDFKLLPDRNIFENLLFVLKATGWTNEVDMNA
RIEDVLDRVGMLQHIRKMPHQISGGEQQRVAIARALLNDPELILADEPTGNLDPQTSVEV
MEVLQQINQNGRTILMATHDYALLLKYPAKTLKCDEGKVFEVVQKTV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory