Protein WP_091525027.1 in Flavobacterium ummariense DS-12

GapMind for catabolism of small carbon sources

Protein WP_091525027.1 in Flavobacterium ummariense DS-12

Annotation: NCBI__GCF_900115115.1:WP_091525027.1

Length: 220 amino acids

Source: GCF_900115115.1 in NCBI

Candidate for 46 steps in catabolism of small carbon sources

Pathway	Step	Score	Similar to	Id.	Cov.	Bits	Other hit	Other id.	Other bits
L-arginine catabolism	artP	med	Arginine transport ATP-binding protein ArtM (characterized)	40%	90%	156.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-cellobiose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	38%	61%	143.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-galactose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	38%	61%	143.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-glucose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	38%	61%	143.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
lactose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	38%	61%	143.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-maltose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	38%	61%	143.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-mannose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	38%	61%	143.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
sucrose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	38%	61%	143.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
trehalose catabolism	glcV	lo	monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)	38%	61%	143.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-citrulline catabolism	AO353_03040	lo	ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)	37%	86%	142.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-histidine catabolism	hisP	lo	Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)	35%	85%	137.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-lysine catabolism	hisP	lo	Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)	35%	85%	137.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-glutamate catabolism	gltL	lo	GluA aka CGL1950, component of Glutamate porter (characterized)	37%	89%	133.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
sucrose catabolism	thuK	lo	ABC transporter (characterized, see rationale)	33%	55%	129.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-maltose catabolism	thuK	lo	Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)	32%	57%	128.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
trehalose catabolism	thuK	lo	Trehalose/maltose import ATP-binding protein MalK; EC 7.5.2.1 (characterized)	32%	57%	128.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
lactose catabolism	lacK	lo	ABC transporter for Lactose, ATPase component (characterized)	34%	58%	125.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-sorbitol (glucitol) catabolism	mtlK	lo	ABC transporter for D-Sorbitol, ATPase component (characterized)	31%	57%	123.2	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-tryptophan catabolism	ecfA2	lo	Energy-coupling factor transporter ATP-binding protein EcfA2; Short=ECF transporter A component EcfA2; EC 7.-.-.- (characterized, see rationale)	36%	73%	122.9	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-fucose catabolism	SM_b21106	lo	ABC transporter for L-Fucose, ATPase component (characterized)	33%	57%	121.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-cellobiose catabolism	gtsD	lo	Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)	32%	56%	119.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-glucose catabolism	gtsD	lo	Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)	32%	56%	119.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
lactose catabolism	gtsD	lo	Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)	32%	56%	119.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-maltose catabolism	gtsD	lo	Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)	32%	56%	119.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-mannose catabolism	TT_C0211	lo	Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)	32%	56%	119.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
sucrose catabolism	gtsD	lo	Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)	32%	56%	119.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
trehalose catabolism	gtsD	lo	Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)	32%	56%	119.4	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-arabinose catabolism	xacJ	lo	Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)	34%	55%	119	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-maltose catabolism	malK1	lo	MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized)	31%	57%	117.1	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-glucosamine (chitosamine) catabolism	SM_b21216	lo	ABC transporter for D-Glucosamine, ATPase component (characterized)	30%	58%	116.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-xylose catabolism	gtsD	lo	ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized)	33%	54%	116.3	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
xylitol catabolism	HSERO_RS17020	lo	ABC-type sugar transport system, ATPase component protein (characterized, see rationale)	33%	52%	115.2	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-cellobiose catabolism	SMc04256	lo	ABC transporter for D-Cellobiose and D-Salicin, ATPase component (characterized)	32%	57%	114.8	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-isoleucine catabolism	livG	lo	ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)	30%	91%	110.2	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-leucine catabolism	livG	lo	ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)	30%	91%	110.2	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-valine catabolism	livG	lo	ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)	30%	91%	110.2	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-phenylalanine catabolism	livG	lo	ABC transporter ATP-binding protein (characterized, see rationale)	32%	88%	109	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-proline catabolism	HSERO_RS00895	lo	ABC transporter ATP-binding protein (characterized, see rationale)	32%	88%	109	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-serine catabolism	Ac3H11_1693	lo	ABC transporter ATP-binding protein (characterized, see rationale)	32%	88%	109	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-tyrosine catabolism	Ac3H11_1693	lo	ABC transporter ATP-binding protein (characterized, see rationale)	32%	88%	109	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
trehalose catabolism	malK	lo	MsmK aka SMU.882, component of The raffinose/stachyose transporter, MsmEFGK (MalK (3.A.1.1.27) can probably substitute for MsmK; Webb et al., 2008). This system may also transport melibiose, isomaltotriose and sucrose as well as isomaltosaccharides (characterized)	33%	51%	108.6	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
D-cellobiose catabolism	TM0027	lo	TM0027, component of β-glucoside porter (Conners et al., 2005). Binds cellobiose, laminaribiose (Nanavati et al. 2006). Regulated by cellobiose-responsive repressor BglR (characterized)	32%	86%	106.7	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-isoleucine catabolism	livF	lo	high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)	31%	90%	99.8	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-leucine catabolism	livF	lo	high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)	31%	90%	99.8	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-phenylalanine catabolism	livF	lo	high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)	31%	90%	99.8	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0
L-valine catabolism	livF	lo	high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized)	31%	90%	99.8	lipoprotein releasing system, ATP-binding protein; EC 3.6.3.-	46%	198.0

Sequence Analysis Tools

View WP_091525027.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MIKAENISKQFNGLEVLKNVSLEIKKGEIVAIVGSSGAGKTTLLQILGVLDDPEKNTNAK
LTINDTDVLSLKDQQLAAFRNKNLGFIFQFHQLLPEFTALENVCIPAFILGKSKTEAEKD
AKELLDYLGLSHRINHFPSELSGGEQQRVAVARALINKPSVIFADEPSGNLDTNSAENLH
ELFFKLRDNFGQTFVIVTHNEELANLADRKLVMSDGKFIV

This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.

Downloads

Candidates (tab-delimited)
Steps (tab-delimited)
Rules (tab-delimited)
Protein sequences (fasta format)
Organisms (tab-delimited)
SQLite3 databases

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
HMMer finds a hit (regardless of coverage or other bits).

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

our ignorance of proteins' functions,
omissions in the gene models,
frame-shift errors in the genome sequence, or
the organism lacks the pathway.

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

the paper from 2019 on GapMind for amino acid biosynthesis
the 2024 update on GapMind for amino acid biosynthesis
the paper from 2022 on GapMind for carbon sources
the source code
instructions for running GapMind on your computer

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory

GapMind for catabolism of small carbon sources