Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate WP_091525027.1 BM253_RS12820 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >NCBI__GCF_900115115.1:WP_091525027.1 Length = 220 Score = 113 bits (283), Expect = 4e-30 Identities = 75/221 (33%), Positives = 121/221 (54%), Gaps = 17/221 (7%) Query: 4 IQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETP---TSGDI 60 I+ +++K+F + ++SL+I E + +VG SG GK+T L++L L+ P T+ + Sbjct: 2 IKAENISKQFNGLEVLKNVSLEIKKGEIVAIVGSSGAGKTTLLQILGVLDDPEKNTNAKL 61 Query: 61 YIGG-DHMNYRVPQ-----NRDIAMVFQDYALYPHMTVRQNI---RFGLEEEEGYTSAER 111 I D ++ + Q N+++ +FQ + L P T +N+ F L + + T AE+ Sbjct: 62 TINDTDVLSLKDQQLAAFRNKNLGFIFQFHQLLPEFTALENVCIPAFILGKSK--TEAEK 119 Query: 112 DERVVEVAETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRA 171 D + E+ + LG++ ++ P ELSGG+QQRVA+ RA++ P V DEP NLD Sbjct: 120 DAK--ELLDYLGLSHRINHFPSELSGGEQQRVAVARALINKPSVIFADEPSGNLDTNSAE 177 Query: 172 EMRTELQNLQDQLAVTTVYVTHNQTEAMTMADRIAVMDDGE 212 + L+D T V VTHN+ E +ADR VM DG+ Sbjct: 178 NLHELFFKLRDNFGQTFVIVTHNE-ELANLADRKLVMSDGK 217 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 220 Length adjustment: 26 Effective length of query: 357 Effective length of database: 194 Effective search space: 69258 Effective search space used: 69258 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory