Align BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_091519040.1 BM253_RS03250 ATP-binding cassette domain-containing protein
Query= TCDB::Q52666 (263 letters) >NCBI__GCF_900115115.1:WP_091519040.1 Length = 227 Score = 121 bits (303), Expect = 1e-32 Identities = 71/205 (34%), Positives = 117/205 (57%), Gaps = 7/205 (3%) Query: 37 VLRDINLTVHRGERIVIAGPSGSGKSTMIRCINRLEEHQSGK-IIVDGIELTSDLKNIDK 95 +L D+N+ +H+GE I + G +GSGKS++++ + + + G+ +IVD T +I Sbjct: 20 ILADVNIDIHKGEFIYLIGKTGSGKSSLMKTLYADLDLKDGEGVIVDYDLRTLKQNDIPF 79 Query: 96 VRSEVGMVFQHFNLFPHLTILENLTL---APIWVRKVPKREAEETAMYYLEKVKIPEQAQ 152 +R ++G+VFQ F L P I ENL A W +V E L++V + + + Sbjct: 80 LRRKLGIVFQDFKLLPDRNIFENLLFVLKATGWTNEVDMNARIEDV---LDRVGMLQHIR 136 Query: 153 KYPGQLSGGQQQRVAIARSLCMKPKIMLFDEPTSALDPEMIKEVLDTMIQLAEEGMTMLC 212 K P Q+SGG+QQRVAIAR+L P+++L DEPT LDP+ EV++ + Q+ + G T+L Sbjct: 137 KMPHQISGGEQQRVAIARALLNDPELILADEPTGNLDPQTSVEVMEVLQQINQNGRTILM 196 Query: 213 VTHEMGFAQAVANRVIFMADGQIVE 237 TH+ + + +G++ E Sbjct: 197 ATHDYALLLKYPAKTLKCDEGKVFE 221 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 227 Length adjustment: 24 Effective length of query: 239 Effective length of database: 203 Effective search space: 48517 Effective search space used: 48517 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory