Align Citrate:H+ symporter (characterized)
to candidate WP_091521441.1 BM253_RS07155 MHS family MFS transporter
Query= TCDB::P16482 (444 letters) >NCBI__GCF_900115115.1:WP_091521441.1 Length = 514 Score = 176 bits (445), Expect = 2e-48 Identities = 100/312 (32%), Positives = 172/312 (55%), Gaps = 11/312 (3%) Query: 30 ILRVTSGNFLEQFDFFLFGFYATYIAHTFFPASSEFASLMMTFAVFGAGFLMRPIGAIVL 89 I+ + G +E +DF++FG A ++ FFP+ + A+ + T A F AGF++RP GA+ Sbjct: 15 IMASSMGTLIEWYDFYIFGSLAIVLSTKFFPSDNPTAAFLSTLATFAAGFVVRPFGALFF 74 Query: 90 GAYIDKVGRRKGLIVTLSIMATGTFLIVLIPSYQTIGLWAPLLVLIGRLLQGFSAGAELG 149 G D +GR+ +VTL +M TF+I +PSY++IG AP++VL+ RLLQG + G E G Sbjct: 75 GRLGDLIGRKYTFMVTLMLMGGATFVIGCVPSYESIGFVAPVIVLVMRLLQGLALGGEYG 134 Query: 150 GVSVYLAEIATPGRKGFYTSWQSGSQQVAIMVAAAMGFALNAVLEPSAISDWGWRIPFLF 209 G + Y+AE A G++GF+TSW + V + ++ + +V+ WGWR+PF Sbjct: 135 GAATYVAEHAPKGQRGFWTSWIQTTATVGLFISLIVILITRSVMTEEQFDLWGWRVPFWL 194 Query: 210 GVLIVPFIFILRRKLEETQEFTARRHH-----LAMRQVFATLLANWQVVIAGMMMVAM-T 263 +++V +++R+ + E+ EF + +++ F N + V+ + M Sbjct: 195 SIVMVYISYLIRKNMSESPEFAKAKKEGKTSTNPLKESFGNRY-NLKFVLLALFGATMGQ 253 Query: 264 TTAFYLITVYAPTFGKKVLMLSAS--DSLLVTLLVAISNFFWLPVGGALSDRFGRRSVLI 321 +Y YA ++ K V+ + ++ D LL L+ + FF G LSD+ GR+ +L+ Sbjct: 254 GVIWYTGQFYAMSYIKTVMFVDSNQVDGLLGIALLLGTPFF--VFFGWLSDKVGRKPILL 311 Query: 322 AMTLLALATAWP 333 A L+A+ + P Sbjct: 312 AGMLIAIISYRP 323 Score = 38.9 bits (89), Expect = 4e-07 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 5/62 (8%) Query: 344 FLMMLSVLLWLSFIYGMYNGAMIPALTEIMPAEVRVAGFSLAYSLATAVFGGFTPVISTA 403 FL+ + VL +++ +YG + L E+ P ++R SL Y + +FGG P IST Sbjct: 414 FLVFVQVL-FVTMVYG----PIAAFLVEMFPVKIRYTSMSLPYHIGNGIFGGLLPAISTY 468 Query: 404 LI 405 + Sbjct: 469 FV 470 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 589 Number of extensions: 38 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 444 Length of database: 514 Length adjustment: 34 Effective length of query: 410 Effective length of database: 480 Effective search space: 196800 Effective search space used: 196800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory