Align ABC transporter for L-Arginine and L-Citrulline, ATPase component (characterized)
to candidate WP_091525598.1 BM253_RS14120 ATP-binding cassette domain-containing protein
Query= reanno::pseudo1_N1B4:Pf1N1B4_3435 (254 letters) >NCBI__GCF_900115115.1:WP_091525598.1 Length = 254 Score = 122 bits (306), Expect = 7e-33 Identities = 74/235 (31%), Positives = 120/235 (51%), Gaps = 11/235 (4%) Query: 4 LEVQDLHKRYGSHEVLKGVSLKAAAGDVISIIGSSGSGKSTFLRCINLLEQPHAGKILLN 63 +EV+DL K + EVLKG++ AG IIG SGSGK+ L+ + + P +G+IL + Sbjct: 2 IEVKDLKKSFDDKEVLKGITTTYEAGKTNLIIGQSGSGKTVMLKTLLGVHIPDSGQILFD 61 Query: 64 NEELKLVANKDGALKAADPKQLQRMRSRLSMVFQHFNLWSHMTAMENIMEAPVHVLGMSK 123 + + DP + + +R+ + MVFQ L+ M ENI S Sbjct: 62 GRDFATL----------DPNEKRTLRTEMGMVFQGSALFDSMNVEENIGFPLKMFTKKSN 111 Query: 124 TEAREKAEHYLNKVGVAHRKDAYPGHMSGGEQQRVAIARALAMEPEVMLFDEPTSALDPE 183 E R++ + +++V + P +SGG Q+RVAIARA+ P+ + DEP S LDP+ Sbjct: 112 AEIRDRVQEVIDRVKLIDANKKMPSEISGGMQKRVAIARAIVNNPKYLFCDEPNSGLDPK 171 Query: 184 LVGDVLKVMQALAQE-GRTMVVVTHEMGFAREVSNQLVFLHKGVVEESGNPREVL 237 + +++Q + E T V+ TH+M ++ + FL G + GN E++ Sbjct: 172 TSIVIDELIQEITHEYNITTVINTHDMNSVLQIGEHICFLKDGKLVWEGNSEEIM 226 Lambda K H 0.317 0.131 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 153 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 254 Length adjustment: 24 Effective length of query: 230 Effective length of database: 230 Effective search space: 52900 Effective search space used: 52900 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory