Align Nodulin-26 aquaporin and glycerol facilitator, NIP (de Paula Santos Martins et al. 2015). Transports NH3 5-fold better than water in Hg2+-sensitive fashion (characterized)
to candidate WP_091518521.1 BM253_RS02445 aquaporin Z
Query= TCDB::P08995 (271 letters) >NCBI__GCF_900115115.1:WP_091518521.1 Length = 234 Score = 147 bits (370), Expect = 3e-40 Identities = 88/229 (38%), Positives = 129/229 (56%), Gaps = 19/229 (8%) Query: 37 LQKLVAEAVGTYFLIFAGCASLVVNENYYNM-ITFPGIAIVWGLVLTVLVYTVGHISGGH 95 ++KL AE GT++L+F GC + V + I G+++ +GL + + Y VGHISGGH Sbjct: 1 MKKLFAEFFGTFWLVFGGCGAAVFAAGVPEIGIGLAGVSLAFGLTVLTMAYAVGHISGGH 60 Query: 96 FNPAVTIAFASTRRFPLIQVPAYVVAQLLGSILASGTLRLLFMG--------------NH 141 FNPAV+ + RFP + Y+V+Q+LG+ A+G L L+ G N Sbjct: 61 FNPAVSFGLFAGGRFPAKDLFPYIVSQVLGASAAAGCLYLILNGAGAFSTEGAGAFATNF 120 Query: 142 DQFSGTVPNGTNL-QAFVFEFIMTFFLMFVICGVATDNRAVGEFAGIAIGSTLLLNVIIG 200 + G ++ AF+ EF++T F + +I G ATD A G+FAGIAIG L L +I Sbjct: 121 YEMEGYAGRSYSMAAAFLAEFLLTAFFLIIILG-ATDKWANGKFAGIAIGLALTLIHLIS 179 Query: 201 GPVTGASMNPARSLGPA-FVHGE-YEGIWIYLLAPVVGAIAGAWVYNIV 247 P+T S+NPARS A FV GE +W++ AP+VGA+ G +Y + Sbjct: 180 IPITNTSVNPARSTSQALFVQGEALSQLWLFWAAPIVGAVVGGLIYKFL 228 Lambda K H 0.323 0.138 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 17 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 271 Length of database: 234 Length adjustment: 24 Effective length of query: 247 Effective length of database: 210 Effective search space: 51870 Effective search space used: 51870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory