Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)
to candidate WP_091519694.1 BM253_RS04260 phosphate ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc02121 (258 letters) >NCBI__GCF_900115115.1:WP_091519694.1 Length = 248 Score = 137 bits (344), Expect = 3e-37 Identities = 81/239 (33%), Positives = 142/239 (59%), Gaps = 10/239 (4%) Query: 23 NMNKWYGDFHVLRDINLRVMRGERIVVAGPSGSGKSTMIRCINRLEE-----HQKGKIVV 77 N+N +G+ HVL++I++ E + GPSG GKST++R NR+ + G + + Sbjct: 9 NLNISFGEKHVLKNISVSFAEHEITALIGPSGCGKSTLLRSFNRMHDLFPDAKINGSLHL 68 Query: 78 DGIELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIWVRKMP-KKEAEQVAMH 136 + ++L + + E+R+ +GMVFQ N FP +I EN + + +P KE Q A+ Sbjct: 69 EELDLYDRHVPVTEIRKRIGMVFQKANPFPK-SIYENIAYG-LKINNLPCNKEVVQKALE 126 Query: 137 FLERVKIPEQALKYPG-QLSGGQQQRVAIARSLCMRPKILLFDEPTSALDPEMVKEVLDT 195 + LK P +LSGGQQQR+ IAR++ +RP+++L DEP SALDP ++ + Sbjct: 127 EAYLWDEVKNDLKMPATRLSGGQQQRLCIARAVALRPEVILMDEPCSALDPVSTLKI-EE 185 Query: 196 MVGLAEEGMTMICVTHEMGFARQVANRVIFMDQGQIVEQNSPAEFFDNPQHERTKLFLS 254 ++ ++ T++ VTH M A+++A++ +FM G++ E+ + E F++P++E T ++S Sbjct: 186 LIKHLKKKYTIVIVTHNMQQAQRIADKTVFMYLGEVKEEGTTDEIFNHPKNEMTANYIS 244 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 248 Length adjustment: 24 Effective length of query: 234 Effective length of database: 224 Effective search space: 52416 Effective search space used: 52416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory