Align BgtA aka SLR1735, component of Arginine/lysine/histidine/glutamine porter (characterized)
to candidate WP_091518577.1 BM253_RS02520 ABC transporter ATP-binding protein
Query= TCDB::P73721 (252 letters) >NCBI__GCF_900115115.1:WP_091518577.1 Length = 233 Score = 140 bits (353), Expect = 2e-38 Identities = 87/222 (39%), Positives = 131/222 (59%), Gaps = 7/222 (3%) Query: 13 QLQKNFGALQVLRGVTGEIYPKDVISIIGPSGCGKSTFLRCLNRLEPISGGRLEVAGVDL 72 Q+ KN AL VL+G+ + + +SI+G SG GKST L + L+ G + V + Sbjct: 12 QMGKN--ALHVLKGINFNVKEGEFVSIMGSSGSGKSTLLNIIGILDEADQGSYTLDNVPI 69 Query: 73 SGAKIDQKHLRQLRVR-VGMVFQHFNLFPHLTVLQNLLLAPRKVLRIPMAEAKDRALTYL 131 +++ Q R + +G VFQ FNL + + L N+ L P + E +R++ YL Sbjct: 70 KN--LNETIASQYRNKFLGFVFQSFNLINYKSALDNVAL-PLYYQGMARKERMERSMHYL 126 Query: 132 DKVGLGTKADNYPDQLSGGQKQRVAIARGLCMKPEILLFDEPTSALDPELVGEVLNVMKQ 191 +KVGL A + P++LSGGQKQRVAIAR L P++LL DEPT ALD + EV+++++Q Sbjct: 127 EKVGLANWAKHLPNELSGGQKQRVAIARALASDPKVLLADEPTGALDTKTSYEVMDLIQQ 186 Query: 192 LAEEGMTMAVVTHEMQFAREVSNRVFFFNQGIIEEEGDPNEV 233 + +EG T+ VVTHE A E++ R+ F G IE + N++ Sbjct: 187 INDEGKTVLVVTHEPDIA-EMTKRIVFLKDGQIESDKLVNQI 227 Lambda K H 0.321 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 233 Length adjustment: 23 Effective length of query: 229 Effective length of database: 210 Effective search space: 48090 Effective search space used: 48090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory