Align 2-keto-isovalerate dehydrogenase component β subunit (EC 1.2.4.4) (characterized)
to candidate WP_091521828.1 BM253_RS07735 pyruvate dehydrogenase complex E1 component subunit beta
Query= metacyc::MONOMER-11684 (327 letters) >NCBI__GCF_900115115.1:WP_091521828.1 Length = 326 Score = 283 bits (723), Expect = 5e-81 Identities = 139/324 (42%), Positives = 214/324 (66%), Gaps = 2/324 (0%) Query: 1 MSVMSYIDAINLAMKEEMERDSRVFVLGEDVGRKGGVFKATAGLYEQFGEERVMDTPLAE 60 M + + +AI AM EEM RD +++++GE+V G +KA+ G+ ++FG +RV+DTP+AE Sbjct: 1 MKTIQFREAICEAMSEEMRRDDKIYLMGEEVAEYNGAYKASKGMLDEFGAKRVIDTPIAE 60 Query: 61 SAIAGVGIGAAMYGMRPIAEMQFADFIMPAVNQIISEAAKIRYRSNNDWSCPIVVRAPYG 120 AG+ +G+AM G+RPI E +F + ++QII+ AAK+R S ++ PIV R P Sbjct: 61 LGFAGIAVGSAMNGLRPIVEFMTFNFSLVGIDQIINNAAKMRQMSGGQFTMPIVFRGPTA 120 Query: 121 GGVHGALYHSQSVEAIFANQPGLKIVMPSTPYDAKGLLKAAVRDEDPVLFFEHKRAYRLI 180 A HSQ+ E FAN PGLK+V+PS PYDAKGLLK+A+RD DPV+F E ++ Y Sbjct: 121 SAGQLAATHSQAFENWFANTPGLKVVVPSNPYDAKGLLKSAIRDNDPVIFMESEQMYG-D 179 Query: 181 KGEVPADDYVLPIGKADVKREGDDITVITYGLCVHFALQAAERLEKDGISAHVVDLRTVY 240 KGEVP +Y +P+G AD+KREG D+T++++G + A AA+ L K+ IS ++DLRTV Sbjct: 180 KGEVPEGEYTIPLGVADIKREGTDVTIVSFGKIIKEAYIAADELAKENISCEIIDLRTVR 239 Query: 241 PLDKEAIIEAASKTGKVLLVTEDTKEGSIMSEVAAIISEHCLFDLDAPIKRLAGPDIPAM 300 P+D +AII++ KT +++++ E S+ SE+ ++ E LDAP++R+ D PA Sbjct: 240 PMDYDAIIKSVQKTNRLVVLEEAWPFASVASEITYMVQERAFDYLDAPVQRITTADTPA- 298 Query: 301 PYAPTMEKYFMVNPDKVEAAMREL 324 PY+P + K ++ N V A++++ Sbjct: 299 PYSPALLKEWLPNAQDVVKAVKKV 322 Lambda K H 0.319 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 278 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 327 Length of database: 326 Length adjustment: 28 Effective length of query: 299 Effective length of database: 298 Effective search space: 89102 Effective search space used: 89102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory