Align 2-keto-isovalerate dehydrogenase component α subunit (EC 1.2.4.4) (characterized)
to candidate WP_091519569.1 BM253_RS04080 alpha-ketoacid dehydrogenase subunit alpha/beta
Query= metacyc::MONOMER-11683 (330 letters) >NCBI__GCF_900115115.1:WP_091519569.1 Length = 658 Score = 177 bits (450), Expect = 5e-49 Identities = 108/293 (36%), Positives = 164/293 (55%), Gaps = 7/293 (2%) Query: 11 LTDQEAVDMYRTMLLARKIDERMWLLNRSGKIPFVISCQGQEAAQVGAAFALDREMDYVL 70 L+ +D+Y+ +L R I+E+M +L R GK+ S GQEA VG L + +Y+L Sbjct: 8 LSQDILLDLYKKLLKPRLIEEKMLILIRQGKVSKWFSGMGQEAIAVGVTSILHND-EYIL 66 Query: 71 PYYRDMGVVLAFGMTAKDLMMSGFAKAADPN--SGGRQMPGHFGQKKNRIVTGSSPVTTQ 128 P +R++GV + + L K PN + GR HFG ++ IV S + Q Sbjct: 67 PMHRNLGVFTSRNIPLSRLFSQWQGK---PNGFTKGRDRSFHFGTQEFNIVGMISHLGPQ 123 Query: 129 VPHAVGIALAGRMEKKDIAAFVTFGEGSSNQGDFHEGANFAAVHKLPVIFMCENNKYAIS 188 + A GIALA ++ K++ V GEG++++GDFHE N AAV LPV+F+ ENN Y +S Sbjct: 124 LGIADGIALAHKLRKENKITAVFTGEGATSEGDFHEALNVAAVWDLPVMFIIENNGYGLS 183 Query: 189 VPYDKQVACENISDRAIGYGMPGVTVNGNDPLEVYQAVKEARERARRGEGPTLIETISYR 248 P +Q CEN++D+ IGYG+ ++GN+ +EVY + E E R+ P LIE ++R Sbjct: 184 TPTREQYKCENLADKGIGYGIESHIIDGNNIVEVYTKLHEIAENMRQNPHPVLIEMKTFR 243 Query: 249 LTPHSSDDDDSSYRGREEVEEAKKSDPLLTYQAYLKETGLLSDEIEQTMLDEI 301 + H + + Y +E EE K DP+ + YL E G+LS+E + + EI Sbjct: 244 MRGH-EEASGTKYIPQELFEEWKIKDPITRFNNYLTEMGILSEEQDAQLRKEI 295 Lambda K H 0.316 0.132 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 423 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 330 Length of database: 658 Length adjustment: 33 Effective length of query: 297 Effective length of database: 625 Effective search space: 185625 Effective search space used: 185625 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory