Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate WP_091517717.1 BM253_RS01100 enoyl-CoA hydratase
Query= BRENDA::F4JML5 (301 letters) >NCBI__GCF_900115115.1:WP_091517717.1 Length = 260 Score = 173 bits (438), Expect = 4e-48 Identities = 99/257 (38%), Positives = 141/257 (54%), Gaps = 2/257 (0%) Query: 46 NRLSGSDSGIIEVNLDRPVTKNAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCA 105 N L ++ + + ++RP NA+NK ++ L NAF+ DN R +++ F A Sbjct: 5 NILVKKNNAVATITINRPTKLNALNKATIEELHNAFKECESDNEVRAIIVTGSGEKAFVA 64 Query: 106 GADLKERRTMSPSEVHTYVNS-LRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRI 164 GAD+ E + + SE +F F+E L P IAA+ G ALGGGLE+A+A +RI Sbjct: 65 GADISEFASFNVSEGSELARKGQELLFDFVENLQTPVIAAVNGFALGGGLELAMAAHIRI 124 Query: 165 CGENAVFGLPETGLAIIPGAGGTQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICV 224 NA GLPE L +IPG GGTQRL +L+G+ + ELI T + IDA A + GL+N V Sbjct: 125 ASNNAKMGLPEVTLGVIPGYGGTQRLPQLIGKGRANELIMTAQMIDAPTALSYGLINHMV 184 Query: 225 TAGEAHEKAIEMAQQINEKGPLAIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRL 284 + E +KA E+A +I + P AI A KA++ + + +G E + T D Sbjct: 185 SQPELLDKATELALKIAKNSPTAISQAIKAVNANFKDGI-NGFNTEIDRFGYCFGTADFK 243 Query: 285 EGLAAFAEKRKPLYTGN 301 EG AF EKRK + GN Sbjct: 244 EGTTAFLEKRKAEFKGN 260 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 260 Length adjustment: 26 Effective length of query: 275 Effective length of database: 234 Effective search space: 64350 Effective search space used: 64350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory