Align ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized)
to candidate WP_091518577.1 BM253_RS02520 ABC transporter ATP-binding protein
Query= TCDB::Q9R9Q4 (342 letters) >NCBI__GCF_900115115.1:WP_091518577.1 Length = 233 Score = 119 bits (299), Expect = 6e-32 Identities = 74/223 (33%), Positives = 120/223 (53%), Gaps = 17/223 (7%) Query: 4 LQLRDIRKSF----GAFDVIKGVSMEIKPGEFMVFVGPSGCGKSTLLRLIAGLEEITSGT 59 ++++D+ KS+ A V+KG++ +K GEF+ +G SG GKSTLL +I L+E G+ Sbjct: 2 IEIKDLHKSYQMGKNALHVLKGINFNVKEGEFVSIMGSSGSGKSTLLNIIGILDEADQGS 61 Query: 60 LAFDGQIVNQLTPS------RRGIAMVFQSYALYPHMTVYENMAFGMQLAGKDKQQCRKR 113 D + L + + + VFQS+ L + + +N+A + G +++ +R Sbjct: 62 YTLDNVPIKNLNETIASQYRNKFLGFVFQSFNLINYKSALDNVALPLYYQGMARKERMER 121 Query: 114 VEAAAEMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVATR 173 E + L + + LP +LSGGQ+QRVAI RA+ DPKV L DEP LD T Sbjct: 122 SMHYLEKVGLANWAKHLPNELSGGQKQRVAIARALASDPKVLLADEPTGALD----TKTS 177 Query: 174 LEIAKLHRSMHK--TTMIYVTHDQVEAMTLADRICVLRDGLVE 214 E+ L + ++ T++ VTH+ + + RI L+DG +E Sbjct: 178 YEVMDLIQQINDEGKTVLVVTHEP-DIAEMTKRIVFLKDGQIE 219 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 233 Length adjustment: 26 Effective length of query: 316 Effective length of database: 207 Effective search space: 65412 Effective search space used: 65412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory