Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate WP_091518577.1 BM253_RS02520 ABC transporter ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >NCBI__GCF_900115115.1:WP_091518577.1 Length = 233 Score = 118 bits (295), Expect = 2e-31 Identities = 80/221 (36%), Positives = 121/221 (54%), Gaps = 17/221 (7%) Query: 6 LKDIRKSY----GAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMF 61 +KD+ KSY A+ V+ GI+ ++KEGEFV +G SG GKSTLL +I L+E G Sbjct: 4 IKDLHKSYQMGKNALHVLKGINFNVKEGEFVSIMGSSGSGKSTLLNIIGILDEADQGSYT 63 Query: 62 IDG---ERVNDVPPSK---RGIAMVFQSYALYPHMTVYDNMAFGMRIARESKEEIDRRVR 115 +D + +N+ S+ + + VFQS+ L + + DN+A + +++E R Sbjct: 64 LDNVPIKNLNETIASQYRNKFLGFVFQSFNLINYKSALDNVALPLYYQGMARKERMERSM 123 Query: 116 GAADMLQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIE 175 + + L + LP LSGGQ+QRVAI RA+ +PKV L DEP LD T E Sbjct: 124 HYLEKVGLANWAKHLPNELSGGQKQRVAIARALASDPKVLLADEPTGALD----TKTSYE 179 Query: 176 IAKLSERMSD--TTMIYVTHDQVEAMTLADRIVVLSAGHIE 214 + L ++++D T++ VTH+ + + RIV L G IE Sbjct: 180 VMDLIQQINDEGKTVLVVTHEP-DIAEMTKRIVFLKDGQIE 219 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 233 Length adjustment: 26 Effective length of query: 336 Effective length of database: 207 Effective search space: 69552 Effective search space used: 69552 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory