Protein WP_009122015.1 in Bacteroides clarus YIT 12056
Annotation: NCBI__GCF_900129655.1:WP_009122015.1
Length: 479 amino acids
Source: GCF_900129655.1 in NCBI
Candidate for 26 steps in catabolism of small carbon sources
| Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
|---|
| myo-inositol catabolism | iolT | med | Inositol transporter 1 (characterized) | 40% | 88% | 311.6 | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) | 38% | 305.1 |
| D-cellobiose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Inositol transporter 1 | 40% | 311.6 |
| D-glucose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Inositol transporter 1 | 40% | 311.6 |
| lactose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Inositol transporter 1 | 40% | 311.6 |
| D-maltose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Inositol transporter 1 | 40% | 311.6 |
| sucrose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Inositol transporter 1 | 40% | 311.6 |
| trehalose catabolism | MFS-glucose | lo | The D-glucose:H+ symporter, GlcP (glucose uptake is inhibited by 2-deoxyglucose, mannose and galactose) (characterized) | 38% | 87% | 305.1 | Inositol transporter 1 | 40% | 311.6 |
| D-galactose catabolism | galP | lo | Galactose-proton symporter; Galactose transporter (characterized) | 35% | 97% | 301.2 | Inositol transporter 1 | 40% | 311.6 |
| D-xylose catabolism | xylT | lo | D-xylose transporter; D-xylose-proton symporter (characterized) | 38% | 94% | 300.1 | Inositol transporter 1 | 40% | 311.6 |
| D-fructose catabolism | glcP | lo | D-fructose transporter, sugar porter family (characterized) | 36% | 95% | 283.5 | Inositol transporter 1 | 40% | 311.6 |
| sucrose catabolism | glcP | lo | D-fructose transporter, sugar porter family (characterized) | 36% | 95% | 283.5 | Inositol transporter 1 | 40% | 311.6 |
| L-arabinose catabolism | araE | lo | Arabinose-proton symporter; Arabinose transporter (characterized) | 34% | 94% | 281.2 | Inositol transporter 1 | 40% | 311.6 |
| D-sorbitol (glucitol) catabolism | SOT | lo | Sorbitol (D-Glucitol):H+ co-transporter, SOT1 (Km for sorbitol of 0.64 mM) of 509 aas and 12 TMSs (Gao et al. 2003). SOT1 of P. cerasus is expressed throughout fruit development, but especially when growth and sorbitol accumulation rates are highest. In leaves, PcSOT1 expression is highest in young, expanding tissues, but substantially less in mature leaves (characterized) | 33% | 92% | 273.1 | Inositol transporter 1 | 40% | 311.6 |
| xylitol catabolism | PLT5 | lo | Polyol (xylitol):H+ symporter, PLT4 (characterized) | 33% | 89% | 269.6 | Inositol transporter 1 | 40% | 311.6 |
| glycerol catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 33% | 88% | 269.2 | Inositol transporter 1 | 40% | 311.6 |
| D-mannitol catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 33% | 88% | 269.2 | Inositol transporter 1 | 40% | 311.6 |
| D-ribose catabolism | PLT5 | lo | polyol transporter 5 (characterized) | 33% | 88% | 269.2 | Inositol transporter 1 | 40% | 311.6 |
| D-fructose catabolism | Slc2a5 | lo | The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) | 32% | 90% | 256.1 | Inositol transporter 1 | 40% | 311.6 |
| sucrose catabolism | Slc2a5 | lo | The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized) | 32% | 90% | 256.1 | Inositol transporter 1 | 40% | 311.6 |
| D-mannose catabolism | STP6 | lo | The high affinity sugar:H+ symporter (sugar uptake) porter of 514 aas and 12 TMSs, STP10. It transports glucose, galactose and mannose, and is therefore a hexose transporter (Rottmann et al. 2016). The 2.4 (characterized) | 30% | 93% | 243 | Inositol transporter 1 | 40% | 311.6 |
| D-fructose catabolism | STP6 | lo | sugar transport protein 6 (characterized) | 31% | 95% | 240.7 | Inositol transporter 1 | 40% | 311.6 |
| myo-inositol catabolism | HMIT | lo | Probable inositol transporter 2 (characterized) | 41% | 58% | 240.7 | Inositol transporter 1 | 40% | 311.6 |
| sucrose catabolism | STP6 | lo | sugar transport protein 6 (characterized) | 31% | 95% | 240.7 | Inositol transporter 1 | 40% | 311.6 |
| trehalose catabolism | TRET1 | lo | Facilitated trehalose transporter Tret1; PvTret1 (characterized) | 34% | 88% | 235 | Inositol transporter 1 | 40% | 311.6 |
| D-glucosamine (chitosamine) catabolism | SLC2A2 | lo | Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 (characterized) | 32% | 79% | 206.8 | Inositol transporter 1 | 40% | 311.6 |
| glycerol catabolism | stl1 | lo | sugar transporter STL1 (characterized) | 30% | 78% | 168.3 | Inositol transporter 1 | 40% | 311.6 |
Sequence Analysis Tools
View WP_009122015.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MKNTNQHKNPVLVYVIAIIAATGGLLFGFDTGVISGAIPFLQKDFGIDDGVIELITTAGL
VGAIAGALFCGKVTDYLGRKKVILASAVIFAIGAVWSGIAPDSTNLILARLFLGIAIGVS
SFAVPLYIAEISPTNIRGTLVSMFQLMVTLGVLVSYLSDLFFADEVDVTCWRPMFYAGIL
PALILLIGMFCMPESPRWLMSKGRKQKAMLILNKIEGHGAAEEVAHSINEEIEKSKNEIS
KWSELIKPTLRTPLFIAIGIMFFQQFVGINTVIYYSPKIFFMAGFDGAVSAIWAAVGVGV
VNVVATLVSIYFVDRLGRRKLYFTGLTGIILSLITLSLSFVFVNELGNAGQWLTVIFMFL
YVAFFAISIGPLGWLIISEVFPQKVRGLGASVGSLSVWVFNSIVSFTFFKIVNALTIPGT
EIMVDGEQVGNPAGAFGFYGLIALLALIWGYFYVPETKGISLEKIEDYWRKGGKPRNLK
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory