Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate WP_009122071.1 BUB52_RS10335 dihydrofolate reductase
Query= SwissProt::Q9C4M5 (331 letters) >NCBI__GCF_900129655.1:WP_009122071.1 Length = 318 Score = 238 bits (606), Expect = 2e-67 Identities = 139/317 (43%), Positives = 194/317 (61%), Gaps = 16/317 (5%) Query: 5 VFITRQIPENGIKMIEKFYEIELWKDPKAPPRGVL----LEK-VREVDALVTLVTDKVDK 59 + +T Q+P+ + I Y+I + P +G++ L++ + DAL+ KV K Sbjct: 4 ILVTHQLPKVAFETIVNDYKIIM------PDKGLISSCMLDRWIGRCDALLPTYAFKVTK 57 Query: 60 ELLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRI 119 E+++ A L+IIA + GYDNID+ A +GI VTN+P + + TA+LAF+LLL VARR+ Sbjct: 58 EIIDRATNLEIIANFGAGYDNIDVNYAITKGILVTNSPKPVIEPTAELAFSLLLNVARRV 117 Query: 120 VEADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYY 179 E D +RS + +V + LG L GKTLGIVG G IGQALA+RA GM+IIYY Sbjct: 118 SECDRKLRSSRGIEIDV----MENLGISLYGKTLGIVGMGAIGQALARRASACGMRIIYY 173 Query: 180 SRTR-KPEAEEEIGAEYVDFETLLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILIN 238 +R R E E A++V LL SDFISLH P T ETYHMI ++ LMKP+ +LIN Sbjct: 174 NRKRLSQEIENVYEADWVSLNELLATSDFISLHAPATSETYHMIDIQQFNLMKPSVVLIN 233 Query: 239 TSRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEARE 298 T+RG +++ LI L+E I GAGLDVFE EP EL +L NV+L+PH G+ T + R Sbjct: 234 TARGNLINERVLIHFLQEKRIFGAGLDVFESEPEIPSELLQLDNVLLSPHNGTGTIDTRV 293 Query: 299 GMAELVAKNLIAFAKGE 315 +N+I + +G+ Sbjct: 294 ESTRYALQNIINYFEGK 310 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 276 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 318 Length adjustment: 28 Effective length of query: 303 Effective length of database: 290 Effective search space: 87870 Effective search space used: 87870 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory