Align fructokinase (EC 2.7.1.4) (characterized)
to candidate WP_009122457.1 BUB52_RS02800 carbohydrate kinase
Query= BRENDA::C4M2I2 (294 letters) >NCBI__GCF_900129655.1:WP_009122457.1 Length = 294 Score = 233 bits (595), Expect = 3e-66 Identities = 128/286 (44%), Positives = 179/286 (62%), Gaps = 4/286 (1%) Query: 8 VAGIGEVVWDCFGDVKKQGGAPCNFAMHMAQFGFESYAFIAVGNDELGKRSLEIIHSFGV 67 V G+GE +WDC + KK GGAP NFA H++QFGF+S AVG D G LE+ G+ Sbjct: 5 VVGMGEALWDCLPEGKKIGGAPANFAYHVSQFGFDSRVVSAVGADADGDEILEVFAQKGL 64 Query: 68 QTIDPVVDYETSTVIITLHN-GIPSYNVKLNVAWDHLKLTDSIIEKAKELDAVCFGTIAQ 126 +T V Y T TV +TL G+P Y +K VAWD++ TD + A AVCFG++AQ Sbjct: 65 RTQIERVPYPTGTVQVTLDAMGVPCYEIKEGVAWDNIPFTDELKRLALNTRAVCFGSLAQ 124 Query: 127 RSEETRKSIIQFLKLMKP--NSFKVFDVNLRQHFYNDDIIQESLSLSNIVKMSDEEIQEV 184 R+E +R +I +FL M K+FD+NLRQ FY +I+ +S+ N++K++DEE+ + Sbjct: 125 RNEVSRITINRFLDTMPDCEEQLKIFDINLRQGFYTKEILCDSMRRCNVLKINDEELVTI 184 Query: 185 GKACGFQGNDLEILKQIH-HQYHLKYSLLTLGEKGSYVYDGTNEIFCEPTKVNVVNTVGA 243 + G+ G DL+ I +Y+LK +LT G GSYV+ F E +V V +TVGA Sbjct: 185 SRIFGYPGIDLQDKCWILLAKYNLKMLILTCGTNGSYVFTPGVVSFQETPRVPVADTVGA 244 Query: 244 GDSFTAIFVGSILKGKSIEQAQKLASKVASYVCTQDSAMPKLTQEL 289 GDSFTA F ++L GK +++A KLA +V++YVCTQ AMP+L Q L Sbjct: 245 GDSFTAAFTSAVLSGKPVQEAHKLAVEVSAYVCTQSGAMPELPQVL 290 Lambda K H 0.318 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 241 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 294 Length of database: 294 Length adjustment: 26 Effective length of query: 268 Effective length of database: 268 Effective search space: 71824 Effective search space used: 71824 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory