Align N-acetylglucosamine kinase (EC 2.7.1.59) (characterized)
to candidate WP_009122352.1 BUB52_RS14525 ROK family protein
Query= metacyc::MONOMER-19002 (326 letters) >NCBI__GCF_900129655.1:WP_009122352.1 Length = 326 Score = 574 bits (1479), Expect = e-168 Identities = 281/326 (86%), Positives = 308/326 (94%), Gaps = 1/326 (0%) Query: 1 MNSSMEKPYVVGIDIGGTNTVFGIVDARGTIIASGAVKTQVYPTVEEYADEVCKNLLPLI 60 MNS+MEKPYVVGIDIGGTNTVFGIVDARGTI+ASG++KT Y E+Y DEVCKNLLPLI Sbjct: 1 MNSNMEKPYVVGIDIGGTNTVFGIVDARGTILASGSIKTGAYERAEDYVDEVCKNLLPLI 60 Query: 61 IANGGVDKIKGIGIGAPNGNYYTGTIEFAPNLPWKGVLPLASMFEERLGIPTALTNDANA 120 IANGGVDKIKGIGIGAPNGNYY+GTIEFAPNLPWKGV+PLA+MFEERLGIPTALTNDANA Sbjct: 61 IANGGVDKIKGIGIGAPNGNYYSGTIEFAPNLPWKGVIPLAAMFEERLGIPTALTNDANA 120 Query: 121 AAVGEMTYGAARGMKDFIMITLGTGVGSGIVINGQVVYGHDGFAGELGHVIVRRD-GRIC 179 AA+GEMTYGAARGMKDFIMITLGTGVGSGIVINGQ+VYGHDGFAGELGH I+RR+ GR+C Sbjct: 121 AAIGEMTYGAARGMKDFIMITLGTGVGSGIVINGQMVYGHDGFAGELGHTIIRRENGRLC 180 Query: 180 GCGRKGCLETYCSATGVARTAREFLAARTDASLLRNIPAESIVSKDVYDAAVQGDKLAQE 239 GCGR GCLETYCSATGVARTAREFL ART+ SLLR+IPAE+I SKDVYDAAVQGDKLAQ+ Sbjct: 181 GCGRHGCLETYCSATGVARTAREFLTARTEPSLLRSIPAENITSKDVYDAAVQGDKLAQD 240 Query: 240 IFEFTGNILGEALADAIAFSSPEAIILFGGLAKSGDYIMKPIMKAMENNLLNIYKGKAKL 299 IF+FTG ILGEALAD IAFSSPEAIILFGGLAKSGDYI KPI KA+++N+L IYKGKAKL Sbjct: 241 IFDFTGTILGEALADFIAFSSPEAIILFGGLAKSGDYIFKPIQKALDDNVLTIYKGKAKL 300 Query: 300 LVSELKDSDAAVLGASALAWELKDLR 325 ++SELKDSDAAVLGASAL WEL+D++ Sbjct: 301 MMSELKDSDAAVLGASALGWELRDIK 326 Lambda K H 0.318 0.138 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 492 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 326 Length of database: 326 Length adjustment: 28 Effective length of query: 298 Effective length of database: 298 Effective search space: 88804 Effective search space used: 88804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory