Align D-galactosamine-6-phosphate deaminase AgaS; GalN-6-P deaminase; Glucosamine-6-phosphate deaminase; GlcN-6-P deaminase; EC 3.5.99.-; EC 3.5.99.6 (characterized)
to candidate WP_072786695.1 BUA36_RS18070 SIS domain-containing protein
Query= SwissProt::A0KYQ7 (386 letters) >NCBI__GCF_900143065.1:WP_072786695.1 Length = 378 Score = 278 bits (711), Expect = 2e-79 Identities = 158/361 (43%), Positives = 224/361 (62%), Gaps = 8/361 (2%) Query: 27 GAFWTAKEISQQPKMWRKVSEQ-HSDNRTIAAWLTPILAKPQLRIILTGAGTSAYIGDVL 85 G TA+EI+ QP +WR+++ ++ IAA+L L PQ R+ILTGAG+SAY+G+++ Sbjct: 16 GGLETAEEIAHQPALWRELAAHLGAEQSRIAAFLGDSLRNPQQRVILTGAGSSAYVGEII 75 Query: 86 AAHIQQHLPLATQQVEAISTTDIVSHPELYLRGNIPTLLISYGRSGNSPESMAAVELAEQ 145 A I P QV AISTT +++HP LYL + PTLL+S+ RSGNSPES AV+L Sbjct: 76 ADEINAAWPC---QVRAISTTSLLTHPALYLDSSAPTLLVSFARSGNSPESTGAVQLVRD 132 Query: 146 LVDDCYHLAITCNGQGKLANYCADKSHCYLYKLPDETHDVSFAMTSSFTCMYLATLLIFA 205 LV + L ITCN +G LA A+ S +P + D FAMTSSFTCM LA L Sbjct: 133 LVPNARFLNITCNAEGDLAQQGANDSASLNLMMPAASCDRGFAMTSSFTCMLLAALSALD 192 Query: 206 PNSQ--ALMQCIEMAEHILTERLADIRLQSEQPSKRVVFLGGGPLKAIAQEAALKYLELT 263 P+ Q L + ++ E A + + + RV++LG GPL+A+A+EAALK +ELT Sbjct: 193 PDFQPERLNKLAQLGEQAQGLWSAPVAALAARRVSRVIYLGSGPLEALAKEAALKIMELT 252 Query: 264 AGQVVSAFESPLGFRHGPKSLVDSHTQVLVMMSSDPYTRQYDNDLIQELKRDNQALSVLT 323 AG V++ S LGFRHGPK+ V+ T VL+ S+DP +R+Y++DL++EL+RD A VLT Sbjct: 253 AGSVMTMANSALGFRHGPKAAVNPETLVLLFRSADPLSRRYEHDLVEELRRDQVAADVLT 312 Query: 324 LSE--ELLTGSSGLNEVWLGLPFILWCQILAIYKAIQLKVSPDNPCPTGQVNRVVQGVNV 381 + + + + WL ++L Q A++++ L++ PDNP G VNRVVQGV + Sbjct: 313 VGAGGDFSIDTPAWPDAWLAPLWLLMAQQYALHQSALLQLRPDNPFKGGIVNRVVQGVTI 372 Query: 382 Y 382 Y Sbjct: 373 Y 373 Lambda K H 0.319 0.133 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 15 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 386 Length of database: 378 Length adjustment: 30 Effective length of query: 356 Effective length of database: 348 Effective search space: 123888 Effective search space used: 123888 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory