Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate WP_076475782.1 BW971_RS01235 MFS transporter
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >NCBI__GCF_900156495.1:WP_076475782.1 Length = 459 Score = 220 bits (560), Expect = 8e-62 Identities = 138/437 (31%), Positives = 223/437 (51%), Gaps = 19/437 (4%) Query: 6 TLPLGSAAVPAKEKTTASRI--KSIFSGSVGNMVEWYDWYVYAAFSLYFAKAFFPKGDTT 63 ++P A+P + R+ K+I + ++GN EWYD+ VYAA + Y AFFP GD Sbjct: 8 SVPSDKTALPDSDTPEGRRLLRKAIGASAMGNATEWYDYGVYAATATYLTNAFFP-GDLG 66 Query: 64 AQLLNTAAIFAVGFLMRPIGGWLMGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETI 123 + T FAV F +RP+GG + G DR GRKA L ++ L+ + +I + P + Sbjct: 67 T--IGTMLGFAVSFALRPLGGMVWGPIGDRIGRKAVLATTILLISVATALIGVLPTHAVA 124 Query: 124 GVGAPILLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGV 183 G+ APILL+ R++QG S GGEYG +AT+++E A ++RG + F + G ++ Sbjct: 125 GIWAPILLILLRVIQGFSTGGEYGGAATFMAEYAPDKKRGRYGCFLEFGTLLGFVMGTAF 184 Query: 184 LIVLQQTLTTEQLYDWGWRIPFAIGALCAIVALYLRRGMEETESFAKKEKSKESAMR--- 240 ++ L+ L+ E + WGWRIPF + ++ LYLRR M +T F + E +E A+ Sbjct: 185 VLFLELGLSDENMQTWGWRIPFFLALPLGLIGLYLRRQMSDTPVFTELE--QEDAIEGTA 242 Query: 241 ------TLLRHPKELMTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLF 294 L + + ++ + G+ + +A YT Y+ YL N +GMS + T Sbjct: 243 WTRFVDLLKNYWQPILVMFGMVIALNVANYTLLAYLPTYLQNNIGMSTTTGTVTILIGEL 302 Query: 295 LFMCLQPIIGGLSDKVGRRPILIAFGILGTLFTVPILTTLHTIQTWWGAFFLIMAALIIV 354 M L P G SD VGR+P+ I +F +P+ + W F+I+ L I Sbjct: 303 AMMALIPFFGRWSDTVGRKPLWWGSLIGLFIFALPLFWLMGQGFAWAIVGFVILGVLYIP 362 Query: 355 SGYTSINAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYI-ALWFKSIGMETGYYWYV 413 +I+A A +FPT++R G + Y + + FGGTA + K+ G + Y+ Sbjct: 363 Q-LATISATFPA-MFPTQVRYAGFAISYNVATAAFGGTAPLVNDAVTKNDGWDLFPAGYM 420 Query: 414 TACIAVSLLVYVTMKDT 430 A A+ ++ +++T Sbjct: 421 MAACAIGMIALPFLRET 437 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 643 Number of extensions: 32 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 459 Length adjustment: 33 Effective length of query: 406 Effective length of database: 426 Effective search space: 172956 Effective search space used: 172956 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory