Align Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (characterized)
to candidate WP_076476938.1 BW971_RS04495 glutamine--fructose-6-phosphate transaminase (isomerizing)
Query= reanno::Caulo:CCNA_00453 (363 letters) >NCBI__GCF_900156495.1:WP_076476938.1 Length = 620 Score = 141 bits (356), Expect = 4e-38 Identities = 117/330 (35%), Positives = 169/330 (51%), Gaps = 36/330 (10%) Query: 56 QRLRANPPRVVVTCARGSSDHAATFARYLIE--TKAGVLTSSAGPSVSSVYDASPNLE-G 112 Q LR VV C G++ HA A+Y IE T+ V A S P L+ Sbjct: 295 QDLRDVDKVFVVAC--GTAYHAGLIAKYAIEHWTRLPVEVELA----SEFRYRDPVLDRS 348 Query: 113 ALYLAISQSGKSPDLLAAVKAAKAAGAHAVALVNVVDSPLAALADEVIPLHAGPELSVAA 172 L +AISQSG++ D L AV+ AK A +A+ N + + +D V+ HAGPE+ VA+ Sbjct: 349 TLVVAISQSGETADTLEAVRHAKEQKARVLAICNTNGAQIPRESDAVLYTHAGPEIGVAS 408 Query: 173 TKSYIAALVAVTQLIAAWTEDAELTA----------ALQDLPTALAAAW-TLDWSLAVER 221 TK ++A +VA T L+ A T AL+ + A+A T++ A+ R Sbjct: 409 TKCFLAQIVA-TYLVGLALAQARGTKYSDEVAREYLALEQMTDAVAQVLETVEPVRALAR 467 Query: 222 -LKTASNLYVLGRGVGFGVALEAALKFKETCGLHAEAFSAAEVLHGPMALVKDGFPALVF 280 L + + LGR VG+ VALE ALK KE +HAE F+A E+ HGP+AL++DG P +V Sbjct: 468 DLSSTDTVLFLGRHVGYPVALEGALKLKELAYIHAEGFAAGELKHGPIALIEDGVPVIVV 527 Query: 281 AQNDESRASV-DEMAAGLR---ARGASVLIAGGGGDAPDALPTLASH--------PVLEP 328 + RA + +M + +R ARGA+ ++ GD A LA H +L+P Sbjct: 528 MPSPVGRAVLHSKMVSNIREIQARGATTIVIAEDGDI--AAAALADHLIVIPRVPTLLQP 585 Query: 329 ILMIQSFYRMANALSVARGYDPDSPPHLNK 358 ++ A A++ ARGYD D P +L K Sbjct: 586 LVSTVPLQAFAAAVAQARGYDVDKPRNLAK 615 Lambda K H 0.315 0.128 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 416 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 620 Length adjustment: 33 Effective length of query: 330 Effective length of database: 587 Effective search space: 193710 Effective search space used: 193710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 24 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory